Odyssey Recruitment

W1siziisijiwmtkvmdmvmtqvmtavmzavmtgvmty4lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Calls for Australia to Legalise Nicotine E-Cigs

Australia should legalise electronic cigarettes with nicotine if the country is serious about improving its health according to a leading academic. Professor Tony Blakely from the University of Melbourne made the claims as he cited the serious impact of tobacco smoking on the health of the nation, and on the country’s healthcare sector. Unlike in the United Kingdom, New Zealand or United States, electronic cigarettes featuring nicotine are only available with a prescription in Australia, and professor Blakely believes that this could be having a negative impact on the country’s population. Studying data from New Zealand, a range of positive outcomes have been identified following the country’s decision to legalise nicotine e-lites, with these no solely linked to the health of individual. According to figures, legalising the devices gained Kiwis around 236,000 quality adjusted life years, with this saving the healthcare system in the country an estimated $815 per person - money that could then be spent on other areas. Despite the positives however Professor Blakely acknowledges accepts that nicotine based electronic cigarettes can be seen as more attractive to young people - however pointed to a joint US/UK report which showed little impact on youth smoking rates when they were introduced. Electronic cigarettes are hugely controversial, with many medics split on their effectiveness. Should they be promoted as an alternative to tobacco, or do they simply transfer the problem? Let us know your views via our social media channels.

W1siziisijiwmtkvmdmvmtqvmtmvmdyvmtavnde1l0dsb2jhbehlywx0aelzc3vlcyaomskucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Global Health Issues 2019: Canada

The biggest health issues are always evolving, with each country and continent having its own challenges. In the first of a new series, Global Health Issues, we’ll take a look at each country we work with, and examine what conditions are most prevalent there. In the first installment we’ll take a look at Canada, a vast country that faces some equally as big challenges. Cardiovascular Disease Cardiovascular disease remains one of the world’s biggest killers, and so it’s little surprise to learn that it remains a huge issue in Canada. Many cases can be brought on by unhealthy lifestyle choices like a poor diet, little exercise and smoking tobacco. Although tobacco consumption rates have dropped in recent years, obesity rates appear to be on the rise - potentially resulting in a great number of cardiovascular issues. According to statistics poorer people are at a 49% greater chance of cardiovascular conditions, with more than 1.6m people now battling heart issues in the country - a figure that has actually dropped slightly since the 1960s. Cancer As with cardiovascular disease, cancer is an issue throughout the world - one which medical researchers have spent a long time studying, with only a small amount of success recorded to date. In Canada Lung, Colorectal, Prostate and Breast Cancer are the most common types of the condition, with more than 200,000 cases diagnosed annually. Current research suggests that around half of all Canadians will get Cancer during their lifetime, with a quarter losing their life as a direct result. This has lead to calls for a more proactive response, focused on the benefits of early screening and ensuring that you avoid any risk factors. Opioid Abuse Aside from some of the larger global issues, Canada also has problems with addiction - especially to opioids. Painkiller addiction is one of the largest issues in the country, with more than 9,000 deaths recorded over the last 16 months as a direct result of individuals overdosing on medication. This has lead to a 73% rise in hospital admissions for opioid poisoning in one state alone. A stigma has started to build up around their use, with the issue potentially growing at a far greater rate than any statistics can show, due to the underground nature of the addiction. Mood Disorders Over 2.6 million people in Canada currently suffer from mood disorders, with this most prominent amongst working age people in the country. Issues related to anxiety and bipolar disorder are the most common, with many cases brought on by an unhealthy work/life balance. It is estimated that, by the age of 40, 50% of Canadians will have experienced at least one mental health issue in their life - with rates amongst young people especially soaring. Whilst still not quite at the stage of New Zealand and Australia, mental illness remains a huge issue in Canada - and with awareness and stigma starting to drop, it looks set to require greater help in years to come. Diabetes Given the increasing rates of obesity and cardiovascular disease, it should come as little surprise that diabetes levels are also on the increase in Canada. Currently more than 3 million people live with the condition, and around 200,000 new cases are being diagnosed annually. As with cardiovascular conditions, wealth can have an impact of your risk factor - with those who are less well off 51% more likely than the wealthiest group in society to have issues with the condition. Campaigns raising awareness around how to avoid type-two diabetes are being rolled out throughout the country, however in many cases it’s already too late. Would a move to Canada interest you? Could you help the country in its battle with any of the conditions outlined above? Register on our website today to start your Odyssey, a dream move could be closer than you might imagine.

W1siziisijiwmtkvmdmvmtmvmtqvndyvmjyvndgwlze5r2xvymfstmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

'Tsunami' of Cancer Cases Expected in Gulf

The Middle East needs a more sustainable strategy for Cancer support, with a possible ‘tsunami of cases’ on the horizon experts have warned. Speaking at the ‘War on Cancer Middle East’ conference in Dubai, healthcare leaders, policymakers and researchers focused on rising rates in the Gulf region, and how these can be strategically dealt with across public and private sectors whilst utilising both preventative and longer term care techniques. Cancer rates have grown staggeringly over the past decade in the Gulf - with rates in the UAE rising by 62%, and those in Saudi Arabia increasing by 49%. These figures may not be as daunting as they initially seem however, with greater awareness of screening and diagnosis at an early stage becoming widespread during this period. The Middle East’s issues with lifestyle related health conditions have again been highlighted as a reason why Cancer is likely to become a huge problem, with around a third of Cancer related deaths linked to lifestyle factors. Dubai is the location that looks set to face the biggest challenges, as Dr Younus Mohammad Ameen Kazem, Dubai Healthcare Corporation CEO, explained: “Dubai is emerging as a population hub within the UAE, with 29% of the country’s population now living there. This share is expected to increase in future due to economic growth, and greater insurance penetration. “The emirate is witnessing a growing burden of morbidity and mortality related to oncology. Oncology care in Dubai is available, but currently fragmented. We are working to enhance current cancer care to offer a world class internationally recognised service to Emiratis, expatriates and foreign health care tourists.” In line with United Nations development goals, the Emirates is aiming to reduce premature deaths from non-communicable diseases by 30% by 2030, with Cleveland Clinic Abu Dhabi’s Chief Medical Officer, Dr Madhu Sasidhar, keen to implement a new approach. He said: “We generally take a top down approach to cancer prevention, but it should begin in schools with education for children on how they can protect themselves from cancer with certain lifestyle choices. “Obesity, lack of exercise and smoking increase the risk of cancer, and children need to be aware of that.” Could you help the Middle East as it battles growing Cancer rates? We’ve got positions on offer in the UAE, Saudi Arabia and Oman on our website - simply visit the jobs section to find out more.

W1siziisijiwmtkvmdmvmdyvmtmvmjkvmtavoduwl09kexnzzxlhdwlkzvjpewfkac5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

The Odyssey Guide to Riyadh

We’ve already taken a look at expat life in Jeddah and so, in the final part in our Odyssey Guides series, we’re going to take a look at another popular Saudi location - Riyadh. Located in the heart of the Kingdom, and home to more than five million people, Riyadh is one of the Middle East’s biggest hubs for business and finance, however it is also more conservative than the relaxed coastal areas of Jeddah in the west or Jubail in the east. This means that it’s vital to do your research before committing to a move. Where to live? Given the size of the city, and how hectic the traffic can be during busy periods, we’d recommend choosing accommodation that’s near your place of work - a lengthy commute in a country with questionable driving standards isn’t how anyone wants to start their day. In terms of popularity and desirability however, there are plenty of good options - almost all of which are based in secure compounds. Al Muhammadiyah is arguably the most sought after district in the city, offering fantastic facilities and top class accommodation that means it isn’t necessary to leave the compound itself too often whilst you settle in. This comes at a cost however, and so many expats (especially those with families) chose to make their money go further by staying in compounds around Al Nakheel, where the spacious villas often come with decent sized gardens. What is there to do? The National Museum - Saudi Arabia is home to a rich culture and history, and Riaydh’s national museum can be a great way to discover more about the Kingdom. Wadi Hanifa - Think of Saudi Arabia and you probably think of arid desert, not the scenic Wadi Hanifa valley that runs through areas of Riyadh. It’s perfect for leisurely walks. Al Watan Park - Looking for a way to entertain young children? Al Watan Park can be perfect, with the family friendly little theme park the ideal place to spend weekends. Where am I likely to be working? Saudi Arabia is home to a strong public and private healthcare sector, however there are also plenty of smaller medical centres that we’d recommend avoiding. There is a relatively even split between medics moving to work in the private sector, and those moving to work in the public facilities, with both offering high quality care within a modern environment. We only work with the larger private healthcare providers, and so any jobs posted on our website will adhere to strict quality standards - with most facilities being accredited by the Joint Commision International. Who is suited to a move? A move to Saudi Arabia can feel like a daunting prospect and, despite the obvious financial benefits, choosing to live in Riyadh is certainly not for everybody. Ideally we’d recommend it to an experienced medic keen to maximise their earning potential, whilst testing their skills in a challenging environment. Medics, and especially those with Western qualifications, will be expected to work independently in the country - with a strong focus placed on them to make decisions based on prior experience. As a result a move isn’t great as a first step overseas for a newly trained medic, nor would it suit someone with little experience of other cultures. If you’ve got the experience however, and a passion to learn more about a fascinating part of the world, then spending a few years in the Desert Kingdom can be an extremely attractive prospect. Why move? 1 - Few locations on earth can offer salaries as high as Saudi Arabia, and a cost of living as low. Riyadh might be one of the more expensive locations in the country, but prices are still well below cities like Dubai or Doha. 2 - You’ll be given more responsibility within the hospital, thus having more freedom to tackle cases in the way you believe best. 3 - Saudi’s rich culture can make a move fascinating and immersive. 4 - Most of the compounds can offer a high standard of living, and plenty of opportunities to meet fellow expats. 5 - Riyadh is home to some high quality international schools, teaching a range of curriculums.

W1siziisijiwmtkvmdmvmdyvmtmvmzmvmjqvmtg2lze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Dammam Hospital to Open Soon

Saudi German Hospital’s flagship new centre in Saudi Arabia’s Eastern Province should open in June bosses have confirmed. Located in Dammam, near the coastal town of Al Khobar and the King Fahd Causeway to Bahrain, the new facility is now said to be two-thirds complete. Covering almost 40,000 square meters, the hospital will boast a capacity of up to 300 beds and 100 clinics, with eight operating theatres - making it one of the largest in the Eastern Province. The facility will become the fifth Saudi German Hospital in the Kingdom, with the group already operating centres in Jeddah, Riyadh, Medina and Khamis Mushait, with Sobhi Batterjee, President of the Group, optimistic about the impact their growing portfolio could have on healthcare in the region. He said: “This is an important milestone for SGH Group as we continue to expand in the region to increase patient access to world-class healthcare. “The Saudi German Hospital in Dammam is a testament to our group’s commitment to ensure that our patients across Saudi Arabia receive best in class healthcare service and expertise. “It also reflects our ambition to continue investing and expanding across Saudi Arabia in addition to other markets from the MENA region, and the world, to improve the health and well-being of communities across the globe.” Is working in Saudi Arabia something which would interest you? If so register on our website and start your journey today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdmvmdyvmtmvmjyvmzqvmzq4lze5twfsdgfozxdzlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Dental Services Needed in Malta

People in Gozo, Malta’s largest secondary island, are in need of better dental services, with recently published research studying 332 patients at a mobile clinic on the island. The findings, which were compiled by the University of Malta’s medical school, showed that 78% of patients required restorative treatment in their gums, whilst two-thirds of those over the age of 20 were missing teeth. Taking a more general look at oral health in the nation, the researchers found that children’s dental health in Malta is fast deteriorating - with a notable rise in tooth erosion noted especially in pre and primary school children. Much of the blame for this has been placed on carbonated and sugary soft drinks which are often targeted at this market. Speaking about their findings, a spokesperson for the research team said: “The findings highlight the need for provision of better dental services in Gozo, re-orientation of existing services to focus on prevention, and the introduction of evidence-based preventive strategies in schoolchildren. “The idea is to change the environment surrounding people making it conducive to the awareness surrounding the importance of oral hygiene. Improvements in economic and educational status, accompanied by policies that promote oral health, all bring about long-term improvements in health in general.” Gozo and Malta are fast becoming hugely attractive with medics seeking a more rewarding career overseas. Could you help the country in its battle with dental issues, or could your skills enhance healthcare in other areas? Register on our website to start your Odyssey today.

W1siziisijiwmtkvmdivmjcvmtqvmdqvmtevntawlze5q2hpbmfozxdzicgxks5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Chinese Research Links Stress & Cancer

Researchers at Dalian University in China have revealed that chronic long-term stress can lead to a growth in Cancerous cells. The results, published last week in the Journal of Clinical Investigation, highlight the impact of Epinephrine - a hormone produced during periods of extensive stress. According to their findings experiencing constant, long-term, feelings of stress leads to epinephrine bonding with ADRB2 in a reaction which boosts levels of the enzyme lactate dehydrogenase. Whilst this can provide an energy boost during a tough time for an individual, a byproduct of it is an organic compound - lactate, which cancer cells feed off to provide them with an energy boost to feed on and grow. After this intriguing discovery, researchers then altered their focus towards combating the impact of epinephrine, with vitamin-C surprisingly shown to reduce tumour growth, albeit the effectiveness can only be assessed after extensive further research. China is fast becoming a hub for advanced medical care and research, making it extremely attractive to medics looking to test their skills in a challenging and fast-paced environment. Is it somewhere that would interest you? Register on our website today for the latest job alerts - a dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdivmjcvmtqvmdkvmdkvmzixlze5r2xvymfstmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Gulf Health Continuing to Drop

Reading time: 3 minutes An increasingly unhealthy lifestyle has seen Gulf nations fall in Bloomberg’s 2019 healthiest country index, with Spain becoming the surprise leader. The study, which examines a range of factors from life expectancy to obesity and exercise rates, saw Bahrain named as the only Gulf location where the nations’ health improved - with The UAE (-3), Kuwait (-22) and Saudi Arabia (-6) all recording sharp falls. At the other end of the table six European nations were joined by Japan (4th), Australia (7th), Singapore (8th) and Israel (10th). Elsewhere Canada ranked 16th - 19 positions above the United States - whilst Malta’s high quality healthcare, and Mediterranean diet saw it ranked 27th. In the Far East China continued to improve, rising three places to 51st - with healthier lifestyles, and a greater awareness of lifestyle related health issues starting to have an impact. Despite positivity in the Far East however, the Gulf’s continual battle with unhealthy lifestyles remains a massive concern to those in the region, which is home to some of the world’s highest rates of diabetes and obesity. Given the issues caused by lifestyle related health, the region’s lack of preventative care was also heavily criticised. Research appears to be the main way in which the Emirates is responding to these challenges, with a long-term study focusing on the causes of heart disease and diabetes in more than 20,000 Emiratis currently being worked on by one of the country’s leading Universities - with factors beyond lifestyle such as environment and genetics being a key focus. Dr Raghib Ali, of the New York University Abu Dhabi, explained why he believes a focus now needs to be placed on an individual to take responsibility for their health. He told ‘The National’: “Although there’s excellent healthcare cover and state of the art facilities in terms of screening programmes for things like diabetes and heart disease, there needs to be more emphasis on that and also on programmes around smoking and improving physical activity.” What is the key to the Gulf sorting its health problem? Let us know you views via our social media channels.

W1siziisijiwmtkvmdivmjcvmtqvmdavmjqvmtq1l09kexnzzxlhdwlkzvn0snmucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

The Odyssey Guide to St John's

To many people a move to Canada means Toronto, Vancouver or Montreal, however most expats will likely have their first job in a more remote location - and St John’s, in stunning Newfoundland and Labrador, is the most sought after of these cities. Although geographically fairly remote, the city has charm in abundance, and the friendly locals and safe streets make it a brilliant place to call home. It certainly won’t suit everyone however, so read on to discover more about one of Canada’s most fascinating cities. Where to live? Unlike the vast modern metropolises we’ve previously covered in this series, St John’s is a small, charming little city that isn’t dominated by enormous skyscrapers and a hectic pace of life. There are plenty of residential options for people looking to make the move, from larger townhouses and family homes, to character apartments in the heart of the vibrant and colourful city centre. What is there to do? Signal Hill - Overlooking the city, Signal Hill was previously a strategic armed forces location, however now it allows for stunning walks with views over St John’s and beyond. The Rooms - A modern art gallery that hosts a range of art dedicated to natural and local history. George Street - Known throughout the city as one of the best locations for a night out, George Street is home to some excellent bars and restaurants. Where am I likely to be working? If you move to St John’s then you’ll be working in the city itself. The small size means that it is home to just a small number of hospitals and most of these are based around the Downtown area - near the harbour. Traffic isn’t a major issue, even at peak times, and Canada’s excellent road network makes commuting into the city centre relatively easy. Who is suited to a move? We think that a move to Canada is great for a younger medic looking for a long-term or permanent relocation, and St John’s is no exception. The quaint little city can be a great place to start your Canadian adventure, with a high-quality, supportive working environment and a relaxed, friendly atmosphere. Combine this with great schools and it starts to look ideal for those with a family. If financial growth is your main reason for seeking a move however we’d suggest looking elsewhere. Wages in Canada is reasonable, but the cost of living can be higher than average - and tax is paid, unlike in the Gulf. Why move? 1 - The local economy is now stronger than ever. 2 - St John’s is home to some fantastic educational facilities for expats with families. 3 - The city is a cultural hotspot, and home to a thriving creative scene. 4 - For someone looking to avoid a hyper-developed modern city, St John’s glorious scenery can be perfect. 5 - As you would expect from Canada the hospitals are ran to an extremely high standard, with medics offered plenty of support when needed.

W1siziisijiwmtkvmdivmjavmtqvndevndevotc1l09kexnzzxlhdwlkzufiduroywjplnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to Abu Dhabi

Reading Time: 3 Minutes Abu Dhabi is one of the United Arab Emirates’ most popular locations. The country’s capital is the main cultural and financial hub of the Emirates, but remains less of a hyper-developed metropolis than Dubai. That makes it extremely appealing to expats looking for a less artificial location experience, but with all the benefits and attractions of the United Arab Emirates. Where to live? Abu Dhabi is home to plenty of popular locations with expats and locals alike, with the general standard of accommodation as high as you’d expect from a city with as prestigious an image. The more suburban areas of Al Karamah and Al Rowdah are popular amongst expats with families. Close to some of the top international schools, and with great transport links to the malls, but without the hectic atmosphere of the city centre, it should little surprise that these areas are so popular with professionals looking to relax at home. If you’re keen to be based closer to the centre of the city, then Downtown Abu Dhabi is a highly sought after and popular location. Space can be at a premium here, but the lively atmosphere and array of high quality restaurants and attractions can make it extremely appealing. What is there to do? Sheikh Zayed Grand Mosque - You couldn’t spend time in Abu Dhabi without visiting the incredible Grand Mosque, an intricately designed building and one of the biggest mosques in the world. Yas Island - A recently developed island, and home to plenty of high quality restaurants, shops and entertainment facilities. The island also hosts Abu Dhabi’s F1 Grand-Prix. Louvre Abu Dhabi - Only officially opened in late 2017, Abu Dhabi’s Louvre aims to bridge the gap between Eastern and Western art. Where am I likely to be working? Abu Dhabi is home to a range of high quality, modern hospitals, with most expats finding roles in the private sector. Burjeel Hospital is one of the most highly regarded, however it is far from alone in the standard of care on offer, with large companies like NMC and Cleveland Clinic also running facilities. There are hospitals throughout the Emirate, however the area around Al-Bateen and Al-Eithad is especially popular. Who is suited to a move? Abu Dhabi can be an expensive place to call home, and it remains slightly more traditional than the expat hub of Dubai. Whilst this allows people moving there a more authentic Arab experience, it won’t suit everyone - especially younger medics, or those seeking a move with little culture. When combined with the relatively independent working environment we believe that Abu Dhabi is best suited to an experienced medic looking to take a break from the monotony of life at home. Expats moving to Abu Dhabi normally stay for between two and five years, with it being increasingly unusual for someone to set-up long-term roots in the Emirate. If you’re looking to experience a new culture, test yourself in a new environment, and live in one of the world’s most impressive cities, but don’t want to leave your home location permanently, then few locations can be better. Why move? 1 - Abu Dhabi is a rich cultural melting pot, where you can meet people from all over the world. 2 - As the UAE aims to move on from an oil-centric economy healthcare is receiving generous investment. 3 - Abu Dhabi is becoming a growing hub for cultural activities in the Gulf, with many concerts, productions and art exhibitions visiting the Emirate. 4 - The cost of living might be high, but few locations on the planet can offer such a luxurious lifestyle. 5 - There’s always lots going on in and around the Emirate, meaning that you shouldn’t ever run out of things to see and do! Interested in moving to Abu Dhabi? Register on our website today for job alerts, and all the latest healthcare news from the area.

W1siziisijiwmtkvmdivmjavmtqvnduvndqvoduyl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

UAE Legalises Vaping

Reading Time: 2 minutes Electronic vaping products are to be legalised in the United Arab Emirates from mid-April, prompting further debate about their effectiveness. Whilst e-cigarettes have been shown to be less harmful than tobacco, doubts still remain over how much more effective they actually are, whilst concerns about the healthier image of e-lites might lead to a rise in the number using them it’s been warned. Government officials who have been discussing whether or not to legalise the devices, have revealed that a growth in the unregulated market prompted them to act, with strict regulations ensuring that they come with health warnings and meet strict safety standards. Globally the e-cigarette market is growing at a rate of around 20% annually, with many proponents arguing that it can be a great way to help people quit smoking tobacco. Despite this however many other groups have been vocal in their opposition to ‘vaping’ products, with different flavours making them particularly appealing to younger people. This was especially a worry for Dr Hassan Mohamed Aref Shabana, consultant respiratory physician at Zulekha Hospital, Sharjah, who told ‘The National’: “In countries where vaping is allowed, school age pupils who were never smokers before have taken up vaping. “This increases the number of those with nicotine addiction at a young age, who will possibly shift towards regular cigarettes later in life. “Vaping may increase nicotine dependence and addiction as it does not have a lasting smell. It can be used in cars, offices, planes and trains, without the smell or social stigma. “As well as that the long-term health damage may only be seen after many years of use.” Is the UAE right to legalise the selling of electronic cigarettes, or should more be done to eradicate smoking completely? Let us know via our social media channels.

W1siziisijiwmtkvmdivmjavmtqvndgvmjevnzc5lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Cervical Cancer to be Wiped Out in Australia

Reading Time: One minute Cervical cancer could be eliminated globally by the end of the century, with Australia on target to be the first nation to eradicate the condition completely. Australia has long been lauded for a high take up of the HPV vaccine, with research published in the Lancet Journal showing that increasing the availability of screening and vaccines should reduce rates to around four per 100,000 women globally by 2100. The HPV virus is responsible for more than 90% of cervical cancer cases, with estimates suggesting that 99.8% of cases in the UK are preventable - highlighting just how important it is to be vaccinated. That has given Professor Karen Canfell, member of the research team at Cancer Council NSW who led the study, hope that elimination should be possible in the not too distant future. She said: “Despite the enormity of the problem, our findings suggest that global elimination is within reach with tools that are already available, provided that both high coverage of HPV vaccination and cervical screening can be achieved.” Can cervical cancer be wiped out within a generation, and how big an achievement would this be? Let us know your views on our social media channels. Interested in moving to Australia? We’ve got a range of exciting opportunities available, simply register on our website to start your journey today.

W1siziisijiwmtkvmdivmtmvmtmvntuvndgvotiwl09tyw5ozxdzlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Oman Healthcare Roundup

Reading time: 2 minutes New Hospital for Dhofar Oman’s Ministry of Health is set to officially open a new £2.4m hospital in the Dhofar Governorate. Funded by Petroleum Development Oman, ‘Shaleem Hospital’ will host an outpatient clinic, emergency unit, radiology department and medical laboratory - despite having just 14 beds. Dhofar, to the south of the country around 1,000km from Muscat, is the largest Governorate in the Sultanate by area - but is home to just 460,000 people, 340,000 of whom reside in the state capital Salalah. Rural Health Targeted A voluntary initiative bringing basic healthcare to some of Oman’s most rural communities has been launched. Eblal (or healing) aims to educate those living in the mountainous regions of the Sultanate on basic first-aid skills, and how to manage common long-term issues like high blood pressure and diabetes. Staffed mainly by teams of medical students, the groups have travelled to areas where the nearest hospitals are more than 50km away - with residents often having little access to transport. As well as initial visits, follow up trips are also planned to help guide villagers onto the right path when working to manage health issues, with hopes high that greater education will lead to better health outcomes for those living outwith the major cities. Work Starts on Dialysis Centre Muscat will soon have a new dialysis centre, with construction underway on a £2m development in the Al-Amarat area of the province. Funded by the heirs of Abdullah bin Moosa Al-Raisi, the new centre will be home to 37 beds (ten of which will be reserved for isolation) and cover more than 1,500 square metres. Diabetes, the number one cause of chronic kidney disease, is becoming a major issue in Oman, with the Sultanate now home to an estimated 80,000 people battling the condition. That makes it all the more vital that more facilities are opened to help cope with the rapidly growing demand. Would you be interested in working in the unique and beautiful Sultanate of Oman? We’ve got a few attractive openings available on our website, register today to start your journey.

W1siziisijiwmtkvmdivmtmvmtmvntivmdqvmtmxlze5tlpozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Childhood Obesity Targeted in NZ

Read time: 1 minute Leaked papers have revealed ambitious plans that aim to have half of children walking or cycling to school in New Zealand by 2030. The country is home to one of the developed world’s highest childhood obesity rates, with the Ministry of Health now keen to stop this alarming trend by promoting everyday physical activity. Documents produced by Government officials have revealed aims to have 60% of schoolchildren attending classes via ‘active transport’ by 2030, whilst an action plan is also to be introduced aimed at increasing exercise participation rates generally over the next 11 years. As with many other locations globally, regular physical exercise rates have dropped slightly among adults in New Zealand, whilst the number of people who are physically inactive has risen to almost 15% of the total population. This comes at a massive cost, with estimates suggesting that the cost of inactivity to the nation is over NZ$1.3bn. Could promoting active travel be the key to getting more young people active, or do bigger steps need to be taken? Let us know your views via our social media channels.

W1siziisijiwmtkvmdivmtmvmtmvndgvndmvoti4l09kexnzzxlhdwlkzu11c2nhdc5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

The Odyssey Guide to Muscat

Reading Time: 3 minutes Oman is often referred to as the Gulf’s hidden gem. The unique Sultanate offers a tremendous mix of traditional Arab culture and architecture, and more modern liberal values and beliefs than many of its neighbours. Considered to be one of the friendliest locations in the region, it’s somewhat of a surprise that it is often overlooked by many considering a move to the area. Especially given the high quality healthcare facilities (and impressive salary packages) on offer in and around the capital city, Muscat. Where to live? Madinat Al Sultan Qaboos is one of the most sought after locations in the city, offering luxurious villas with gardens that are ideal for families. There are plenty of modern apartments for smaller groups too, and the district is just a kilometer away from golden beaches and a cooling breeze. If you’re looking for a seriously luxurious standard of living then Shati Al Qurm is the best option. Located near the Royal Muscat Opera House, accommodation comes at a cost, but to many who find a dream home there, it’s one worth paying. For a medic looking to maximise their earnings, the area of Ruwi in the heart of the city could be an attractive option. Prices are lower here, but the quality of accommodation can vary dramatically - making it vital that you view a property before committing to a rental agreement. What is there to do? Royal Opera House - Opened in 2011, but built in a stunning classical style, it is Oman’s premier arts venue. National Museum of Oman - Keen to discover more about the Sultanate? Oman’s national museum, located in Old Muscat, provides a fascinating glimpse into the city’s past. Al Riyam Park and Corniche - The perfect place from which to appreciate Muscat’s unique charm, you can take a stroll as the sun sets over the harbour. Where am I likely to be working? Most hospitals in Muscat are located in the north, or north-east of the city, however as a large area it can take almost an hour to travel from one side of the city to the other. The large high-quality hospitals are often located near the popular expat areas and international schools, however we’d always recommend that you know your commute before signing a rental contract. Traffic might be more manageable than in the UAE at peak times, however the roads can still be hectic. Who is suited to a move? We think a move is ideal for experienced medics taking their first steps into the Gulf region. Oman’s friendly atmosphere and relatively liberal laws make it an easier introduction to the Middle East for expats, whilst experience is vital when working in a department with few other Western trained physicians. People with young families will also appreciate the lifestyle and safety, however those with slightly older children may find themselves struggling for things to do. We also wouldn’t recommend Oman to those with little experience, as a lot of independent working and problem solving can be required. Whoever you are however one thing is for certain, you’ll be warmly welcomed into the Omani way of life. Why move? 1 - The city still has a rich identity that hasn’t been eroded by new developments and high-rise buildings. 2 - Tax free salary packages can make a move extremely rewarding financially. 3 - There are a range of outstanding international schools. 4 - Oman is home to plenty of untainted natural beauty. 5 - By Gulf standards the Sultanate is relatively liberal, certainly far more so than Saudi Arabia, Kuwait and even the UAE. Would you be interested in a move to Oman? Register on our website today to start your journey, a dream move could be closer than you might imagine.

W1siziisijiwmtkvmdivmdyvmtmvndgvndivotk3l1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Boost for UAE Donors

Organ donation in the UAE is being made easier thanks to integration with smart technology and residents’ Emirates ID cards. Due to be launched later this year, the new smart health card will contain basic medical information about residents, including their blood type, allergies and any chronic disease - with whether or not they wish to donate their organs after death now also included. Residents keen to become donors have to follow four simple steps, the first of which is to download the ‘Hayat’ mobile application. After they submit their basic details (such as their name, age and Emirates ID number) via the app, an email is sent to the individuals’ registered address that, when confirmed, confirms their place on the donor register. Director of public health policy at the Ministry of Health, Lubna Al Sha’ali, highlighted the important role that technology will play in the development. She said: “The third phase we will use artificial intelligence to match donors with recipients based on Human Leukocyte Antigen matching and DNA verification. “This data will be stored with us for use in future if the donor dies and their organs can be harvested.” The United Arab Emirates is still one of the most popular locations we work with. Would you be interested in a move to the country? If so register on our website today, a dream job could be far closer than you might imagine.

W1siziisijiwmtkvmdivmdyvmtmvndivntcvmte1l09kexnzzxlhdwlkzu1hbhrhlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to Malta

Malta probably isn’t somewhere that you’ve considered moving, with the small Mediterranean island often thought of as more of a holiday destination for Europeans. That might be changing however, with the country keen to grow the healthcare sector that once saw it named the Nurse of the Mediterranean. Find out more about Malta’s plans to develop healthcare in our exclusive feature. Where to live? Despite its small size, Malta can offer a range of living options that are sure to suit almost everybody. For those looking to be in the heart of the action, the capital city Valletta is by some distance the best option. A UNESCO World Heritage Site, Valletta is steeped in Baroque charm and home to a stunning natural harbour. For those looking for a slightly more contemporary lifestyle then the nearby town of Sliema is upbeat and vibrant, with property prices slightly lower than those in the capital. Both of these options involve bustling towns however, and we know that isn’t for everyone. If you’re looking for a more relaxed pace-of-life then the south of the island could be more attractive - especially the small fishing town of Marsaxlokk. Not only does it offer a slower lifestyle, it’s also based around a stunning bay and home to a friendly, mainly local, population. What is there to do? As somewhat of a tourist hub for Italians, Spanish and British, there is plenty to see and do in Malta. St John’s Co-Cathedral - Arguably the most beautiful and iconic building in Malta, St John’s Cathedral was built between 1573 and 1577 and remains one of the most popular attractions on the island. Mdina Old City - Fans of historical architecture are well served in Malta, with Mdina Old City the perfect place for a leisurely stroll through the country’s rich past. Playmobil-FunPark - Totally changing the tone is Playmobil FunPark, the second largest Playmobil factory in the world and home to plenty of themed activities for children Where am I likely to be working? Malta is a small island, and as a result the majority of major hospitals are based in and around the capital city, Valletta. This is where we’d imagine that you’ll be working, but commuting in to the city from around the island is easy - it takes under an hour to drive from Millieha in the north to Tal-Papa in the south - so living and working in different towns shouldn’t create much of an issue. Who is suited to a move? We think that Malta’s relatively relaxed pace of life and need for experienced medics makes it ideal for older professionals looking to get the most out of their careers. That’s not to say that Malta doesn’t work for younger medics with families, the island is safe, home to plenty of good schools and has plenty to keep children occupied - but further afield locations like Australia and New Zealand can probably offer more. Why move? Here are five of the best reasons to move to Malta today: 1 - The cost of living in Malta is low, especially for basics like food and utilities. 2 - Malta gets 300 days of sun every year - and winters are short and relatively warm. 3 - Malta is home to one of Europe’s best healthcare systems. 4 - The typical, relaxed island pace of life can be a great change from the hectic lifestyle endured in mainland cities. 5 - Despite having its own rich culture, Malta is very near mainland Europe. Plenty of cheap, quick flights to Italy, France, Switzerland and Greece are available - making it the ideal place from where to explore the region. Interested in Malta? We’re hoping to bring a new range of jobs from the country to our website very soon. To get ahead of the rest register online today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdivmdyvmtmvndyvmjkvodc4lze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Saudi Tackling Tobacco

Saudi Arabia’s Ministry of Health has followed World Health Organisation advice by launching a nationwide survey on tobacco use. Targeting 12,800 respondents over the next two months, hopes are high that the results will allow the Saudi Government to implement more successful strategies aimed at reducing tobacco use in the Desert Kingdom. The most recent statistics have shown that around 12% of Saudis over the age of 15 regularly smoke tobacco - a figure slightly below that of the UK and UAE, but still above Qatar. Estimates suggest that smoking costs the global healthcare market more than $420bn annually, making it vital that rates continue to drop. Along with the WHO survey, Saudi Arabia has also been proactive on its own, introducing a smartphone application that allows users to report people for smoking in public areas, or any shops that sell cigarettes to children. As well as this nationwide strategies have also been introduced to raise awareness of the health issues caused by tobacco consumption, with hopes high that the Kingdom will be able to stub out the habit in the not too distant future. Would you be interested in a move to Saudi Arabia? We’ve currently got a range of openings in the Kingdom on our website, with a number of attractive posts available in Buraydah. Find out more and apply online today.

W1siziisijiwmtkvmdevmzevmtavntqvnduvndqylze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Thinking of a Move to Saudi Arabia?

Anyone looking to work in Saudi Arabia’s healthcare sector will need to complete their ‘DataFlow’ before taking a role Odyssey have been informed. DataFlow is the name given to the primary source verification software used by the Kingdom’s healthcare sector, with candidates uploading personal documents to prove their credentials. Our contacts in the Kingdom have been in touch to advise us that employers are unlikely to book a new employees’ flight or accommodation until their qualifications, employment history and medical licenses have been verified by DataFlow. Whilst this can be an inconvenience, it also represents a great opportunity for medics keen on a move to the Kingdom to get ahead of the rest. Completing your DataFlow, which will take a few hours online if you have the documents to hand, and then around a month to verify, can help to give you the edge when competing in a competitive market. For more information, and to start your application, visit the DataFlow website.

W1siziisijiwmtkvmdevmzevmtavntcvntcvode3lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Early Risers at a Lower Risk of Mental Illness

Early risers are at a lower risk of mental health issues than those who struggle with mornings according to a major new report. The genetic study of more than 700,000 people, co-authored by academics at Queensland University Australia, revealed that those with a genetic disposition to wake earlier found themselves at a far lower risk of schizophrenia or depression than those who found themself comfortably able to stay awake all night. This builds on previous studies which have put so called ‘night owls’ at a higher risk of depression, type-two diabetes and obesity. The role of the body’s biological clock is vital in understanding a person’s natural routine, with the study showing that early risers’ fitted perfectly with a standard 9-5 day - whilst night owls’ did not. Contrary to public beliefs it isn’t possible to become a morning person either, with an individual's’ genetic identity playing a vital role in deciding how easy someone found getting up outwith their natural routine. Are you more of a night owl or an early riser, and how does this relate to the rest of your family? Let us know on our social media channels.

W1siziisijiwmtkvmdevmzevmtevmtevmdqvmzmxl09kexnzzxlhdwlkzuf1y2tsyw5klnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to Auckland

New Zealand has always attracted a steady stream of people seeking a better life overseas, and Auckland is often the most sought after destination. Ranked as the third best city in the world for quality of life, it should come as little surprise that a move comes at a price - however it’s one worth paying if you’re looking for a lifestyle enhancing change. Where to live? Auckland has plenty of locations to choose from for all kinds of expats. Whether you’re a young medic looking for a vibrant community, or a more experienced physician seeking a slower pace of life, here are three of the most popular. Best for young medics - We’ve had a few more junior roles on offer in Auckland over the past year, and Ponsonby is always popular with a young crowd. Close to the city centre, but with a bustling selection of independent businesses and a great local music scene, it’s perfect for someone looking to be in the heart of the action. Best for families - Parnell is one of New Zealand’s most sought after locations, sitting just two kilometers from the city centre, it offers a slower pace of life, high quality local amenities and some stunning family homes. Best for more experienced medics - Mangere Bridge is ideal for those seeking a quieter life, whilst still being only half-an-hour from the centre of Auckland. This scenic little suburb can offer great accommodation and a range of community groups. What is there to do? Queen Street - Auckland’s main shopping area, Queen Street is in the bustling heart of the city. Auckland Art Gallery Toi O Tamaki - Host of the biggest collection of national and international art in New Zealand, this isn’t one to miss out on. Waiheke Island - No visit to New Zealand would be complete without visiting a vineyard, and Waiheke Island is home to one of the country’s most scenic. Where am I likely to be working? When you first move to New Zealand it’s likely that you’ll be working in a more rural setting away from major cities like Auckland, however if you do manage to find a role in the city then it’ll likely be in a medium sized hospital. Aside from Auckland City Hospital itself, Auckland has few large medical facilities - allowing physicians to build up a strong relationship as a member of a smaller team. These can offer a high standard of care within a modern environment. If a move to Auckland is more of a long-term goal, and you’re working outside of the city, then you’ll likely find yourself in a District Hospital. Again these tend to be relatively small in size, but play a vital role in the healthcare of a semi-rural community. Who is suited to a move? We believe that a move is perfectly suited to someone looking for a long-term relocation. Auckland’s high standard of living, educational facilities and medical care makes it idea for raising a family - whilst New Zealand’s stunning scenery and busy cities can be great fun to explore. For someone moving from Western Europe there will be little culture shock and - distance aside - it’s hard to think of an immediate downside. If you’re solely focused on enhancing your finances, or experiencing a totally unique culture, then we’d probably recommend elsewhere, however for anyone else few locations can offer such long-term stability as New Zealand. Why move? Here are five reasons to go for it! For more information on moving to New Zealand, and the latest job alerts from the country, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmjmvmtqvmzavmdyvnzyxlze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Australia Targets Sugary Drinks

A controversial new advertising campaign raising awareness of the impact sugary beverages can have on dental health has been launched in Australia. Labelled ‘misguided’ and ‘lacking evidence’ by the Australian Beverages Council, the new joint group campaign shows glamorous soft drink consumers with rotten teeth and serious dental decay. The Australian Dental Association and Diabetes Australia are two of the biggest supporters of the new campaign, with a total of 14 community health groups calling for the implementation of a new six point plan to reduce consumption in the country. This comprises: A 20% levy on sugary drinks A Government backed marketing campaign to raise awareness of the health risks associated with sugary drinks Restrictions on marketing targeted at children Restrictions on the sale of beverages at schools, state buildings and children’s sports events State policies to reduce the availability of sugary drinks in the workplace Easy access to fluoridated tap water Dramatic tooth decay has been found in people who consume more than 1.5 litres of sugary soft drinks daily, with hopes high that the shocking nature of the new campaign will get it noticed by more young people. Do you support the use of more graphic imagery in raising awareness of the health issues caused by unhealthy lifestyle choices? Let us know on our social media channels.

W1siziisijiwmtkvmdevmjmvmtqvmjmvmdavnjk4l09kexnzzxlhdwlkzuplzgrhac5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

The Odyssey Guide to Jeddah

Expats moving to Saudi Arabia tend to end up in either Riyadh or Jeddah. Both cities are home to high quality healthcare facilities, plenty of amenities and expat-friendly compounds. Jeddah’s more relaxed atmosphere however makes it a particular favourite, especially with those looking for a less intensive Saudi experience. Where to live? Most expats moving to Jeddah will choose to live in one of the city’s compounds. These offer a very secure, almost Western standard of living, with impressive villas, apartments and communal facilities that make them ideal for families. Arabian Homes are one of the most established compound suppliers in the region, and they run four villages in Jeddah - all of which are located near the airport and other local attractions. Elite Compounds and the recently constructed Divona also offer a high quality of living, however they are far from the only attractive options. If you’re more adventurous, or keen to maximise your money, then you can live in the city itself, however standards and security levels are far lower than in the compounds, so we would only recommend this to someone with a decent knowledge of the city. What is there to do? Many people moving to Saudi Arabia are put off by the lack of tourist attractions, however that is slowly changing as the Kingdom starts to open its doors to more and more visitors. Here are three things to consider visiting: Fakieh Aquarium - One of Saudi’s premier tourist attractions, the aquarium is home to a fascinating selection of marine life. Athr Gallery - A thought provoking contemporary art gallery located just off Jeddah’s main shopping area - Tahlia Street. Al-Shallal Theme Park - Covering 60,000 square meters this park has long been popular with families. Where am I likely to be working? Jeddah is home to some excellent public and privately owned hospitals and medical centres, and the demand tends to change depending on when you are looking to start, the speciality and your qualifications. At the moment we’ve got a range of openings in Government owned facilities. The Saudi Ministry of Health has split the healthcare system into four - with public hospitals, Ministry of Defence and Aviation (MODA), Interior Ministry (MOI) and Saudi National Guard (SANG) facilities Kingdom-wide. These all offer a high standard of care, attractive salary packages and good locations in the heart of the city. Who is suited to a move? Saudi Arabia is well suited for an experienced medic looking to increase their savings, via a short-term move overseas. Most people moving to Saudi only stay for between two and four years, which is enough time to sample the culture, boost your bank balance and test your professional skills within a new environment. As with the rest of the Gulf a lot of focus is placed on the importance of working independently, so we’d only recommend it to someone with a decent chunk of post-qualification experience back home. Why move? Looking for a few reasons to move to Jeddah? Here are five: 1 - You’ll be given more responsibility within the hospital, thus having more freedom to tackle cases in the way you believe best. 2 - Financial attractions are a given, high tax-free salaries and a relatively low cost of living makes moving to Jeddah extremely lucrative. 3 - The city is home to a vast range of restaurants, serving incredible food from all around the world. 4 - A move to one of the Gulf’s most historically significant cities can be a unique cultural experience. 5 - Jeddah itself looks absolutely beautiful at night, when lighting turns it from a sandy, dusty beige into a warm gold and black. If a move to Jeddah is something that would interest you register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmjmvmtqvmjuvndavmze0lze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Elementary Health Checks in Saudi

Saudi Arabia’s Ministry of Health has launched a new campaign focused on the wellbeing of school children in the Kingdom. Government officials are hopeful that the new joint Ministry of Health and Ministry of Education venture will reach around 50% of the country’s elementary school pupils, with the scheme encouraging healthy lifestyles and carrying out a range of tests aimed at detecting any future health issues at an early stage. The tests will cover an array of areas; from dental health to vision, hearing and behavioral examinations. A social media campaign is also being launched to help raise awareness for those who aren’t taking part, with the importance of regular check-ups and early diagnosis being stressed throughout these. Saudi Arabia has a major issue with childhood health, with WHO statistics showing that a staggering 17.1% of children under the age of five are overweight or obese in the Kingdom. Not only will this put them at a greater risk of serious health issues in later life, it can also put a major strain on the country’s healthcare system. Would you like to help Saudi in its quest to help young people to make healthier choices? If you would, register on our website today for job alerts. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdevmtcvmtavmtkvntcvmzu1lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Northern Territory Suicide Hotspot

More than three times as many children are taking their life in the Northern Territory when compared to other Australian states a new report has revealed. Australian National Bureau of Statistics figures have shown that there have been 13.9 deaths per 100,000 young people in the Territory, whilst in other states this ranged from just 1.7 to 3.6. The figures for indigenous groups are especially concerning, with almost half of all young people taking their life in the country being from that demographic - despite them making up less than 5% of the total population, with one victim being as young as 12 years old. Northern Territory appears to have a major issue with people being prepared to seek support, with just 0.4% of the suicide prevention helping ‘Lifeline’ coming from the region. This is despite more than $53m being spent on local mental health services, including campaigns aimed at de-stigmatizing the image of mental illness. Government officials are now targeting greater community healthcare programmes, to help reach out to Territorians - and especially young people - from an early stage. Could you help Australia as it continues to battle mental illness? Register on our website today for job alerts. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdevmtcvmtavmtivntgvnjyxl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

New License in Dubai

Visiting physicians, dentists and allied health professionals will soon be able to apply for a two year ‘Visiting Doctor’s License’ in Dubai, allowing them to work in up to three facilities in the healthcare city development. The move has been introduced in an attempt to attract more highly qualified Western physicians to the Emirate, as part of the ‘50 Year Charter’ initiative that aims to improve the quality of life for everyone living in Dubai. Currently visiting medics are only able to apply for short-term licenses which have to be renewed every three months, however from January 20 the new option will offer greater long term security. Anyone eligible can apply online from overseas and once a letter of acceptance has been received they’ll be able to sponsor their family - with Dubai Healthcare City itself sponsoring the individual. Speaking about the new license, CEO of Dubai Healthcare City Authority, Dr Ramadan Al Blooshi, said: “Attracting global medical expertise to serve the health of our citizens is one of the main pillars of the transformation of Dubai's medical system." "The new 'Visiting Doctor's License' will help us to achieve this as it provides flexibility and mobility for global, high-caliber physicians wishing to work in Dubai Healthcare City, consequently increasing unique expertise in the free zone.” Anyone eligible can register on the DHCR website.

W1siziisijiwmtkvmdevmtyvmtqvndgvmtcvndg2l09kexnzzxlhdwlkzvnoyw5nagfplnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to Shanghai

Shanghai is one of the most sought after locations in the Far East for expats seeking a move to the region, and thanks to recent developments we’ve got a range of openings on offer in the city. Before committing to a move however, we’ve made a little guide to let you know what to expect. Where to live? Shanghai is enormous, and so choosing where to live is likely to depend on whereabouts you’re working. Most of the popular expat areas are near the best international schools however, with Hangqiao and Pudong two of the most sought after thanks to their high quality accommodation, local amenities and proximity to major airports. Most expats will likely live in a high rise apartment block, with these offering a comfortable, spacious standard of living - however a small number of townhouses are available too, though they can come at a premium. What is there to do? As you’d expect from such large city, with such a rich history, there is plenty to see and do around Shanghai. Nanjing Road - The most popular shopping street in the city, Nanjing Road is home to plenty of world famous brands, and smaller independent retailers. Shanghai World Financial Centre Observation Deck - On a clear day nowhere can offer as stunning a view of the city as one of the world’s highest observation decks. Zhujiajiao Water Town - Shanghai has an image as a modern metropolis, however venture a short distance outside and you can feel as if you’ve stepped back in time - with the Zhujiajiao’s history stretching back for more than 1700 years. Where am I likely to be working? As China continues to develop and invites more private investors into the country, Shanghai’s healthcare sector continues to grow. This is happening exponentially at the moment, and so it’s difficult to provide an exact hospital name or location. What we can say however is that it’s likely that you’ll be working within the private sector, probably for a facility joint managed by both Chinese and International companies. Who is suited to a move? We think that a move to China is ideal for an experienced expat medic, seeking to make a real impact overseas. As many of the facilities have only recently opened they are looking for well-trained medics to take on management and teaching roles. Salaries, whilst high, are subject to taxation (unlike in the Gulf) and hours can be long, so a move isn’t suitable for someone looking to wind down their career whilst exploring a new country. Why move? There are a vast range of reasons to move to Shanghai. Here are a few of the best. Cultural Experience - Moving to China is a unique cultural experience, and moving to Shanghai can offer a great blend between modern and traditional China. Influence - A move to Shanghai represents an opportunity to make a real difference, where you can introduce the foundations for the future of healthcare in the city. Safety - Despite the size of the city, Shanghai is extremely safe for expats. Futureproof - China is home to one of the world’s fastest developing economies, and with the Gulf slowing down slightly a move to China can be close to futureproof. Public Transport - Getting around Shanghai can seem daunting, but the city (and China in general) is home to a great public transport system - that makes exploring easy. For more information about moving to Sharjah, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdkvmtqvndivmzgvmjgzl01hbhrhrmvhdhvyzs5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Malta - Europe's Healthcare Hub

Malta has set its sights on becoming a European healthcare hub, by inviting private investors to make the island a health tourism capital. Despite its small size, Malta has a rich history as a healthcare power. From opening its first public hospital back in 1327, to providing healthcare during World War 1, it’s little surprise that the country is known as ‘The Nurse of the Mediterranean’. Now however it’s keen to start developing for the future, by investing in world class technology and talent to cement its position as a hub for health tourism. To combat the demands that come with an ageing population, the Maltese Government has introduced policies aimed at attracting private investors. A major part of this has been the establishment of new partnerships with international healthcare providers and some of the world’s most highly regarded medical schools. Of the healthcare groups entering the country, Vitals Global were one of the first, with the group investing €220m in two Maltese hospitals and one in the nearby island of Gozo, aimed at attracting medical tourists from throughout Europe. After two years the Maltese arm of VG was bought out by Texas based Steward Health Care, who have continued to develop facilities in the country. Medical tourism isn’t the only focus in Malta however, the country is also committed to investing in the next generation of doctors, nurses and allied health professionals. A brand new medical school in Gozo opened its doors in September 2017, run by Barts and The London School of Medicine and Dentistry, whilst the Royal College of Surgeons Ireland made Malta a centre for examinations. That means that a move to the country isn’t just for someone looking to develop their own professional skills, it’s also ideal for someone interested in educating the next generation of medical staff. Is a move to Malta something you’d consider? At the moment we only have one vacancy in the country, but we’re expecting that (and interest) to grow exponentially over the coming year. To get ahead of the rest register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdkvmtqvmzgvmzcvnzuylze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Boost for Mental Health in Australia

Headspace, one of Australia’s biggest youth mental health organisations, is to benefit from an additional AU$47m in funding. Established by the country’s government 13 years ago, the group offers support to young people between the ages of 13 and 25 on a range of topics, from anxiety to family issues. Currently the group operate more than 100 facilities nationwide, with the new grant ensuring their future until at least the winter of 2023. The funding boost will also allow for new techniques to be introduced, after recently released statistics showed that almost 500,000 people between the ages of 16 and 24 experienced a mental health problem each year. This will include a nationwide roadshow where young people will talk about their mental health challenges, and how Headspace has supported them. Hopes are high that greater support from an early stage, along with greater visibility of positive role models will help to remove some of the fear and stigma surrounding mental illness. Speaking about the funding boost Greg Hunt, Health Minister, said: “If we can take the steps in the early years to give people a pathway to recovery, then we can make a lifelong difference in terms of their quality of life, their experience and their families lives.” Would you be interested in helping Australia as it battles sky-high youth mental health rates? Register on our website today for job alerts. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdkvmtqvmzuvmzivnti2l09kexnzzxlhdwlkzvnoyxjqywgucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

The Odyssey Guide to - Sharjah

Sharjah is often overlooked by expats seeking a move to the United Arab Emirates, despite being close to Dubai - and offering a high standard of living at a fraction of the price. Recently the Emirate has started developing its medical education infrastructure too - making it even more attractive to medics looking to make the UAE their home. Where to live? Sharjah is a relatively small Emirate compared to Dubai, and is home to just 1.4 million people (compared to Dubai’s 3.1m) making it ideal for expats seeking more space for their money. Al Qasimia near the iconic King Faisal Mosque is a popular location, with plenty of shops, supermarkets and restaurants within easy walking distance. If you’re looking for a more scenic outlook then the waterfront town of Al Khan is popular - especially with those who are into watersports. If you’re moving with a young family and are keen to take advantage of the extra space that a move to Sharjah can allow, then Al Falaj is a great option. It’s one of the most sought after addresses in the Emirate, and is home to some stunning family villas. What is there to do? Sharjah might not be home to as many attractions as Dubai, but it does have a name as the UAE’s cultural capital. Sharjah Art Museum - Has two floors of art on display, from historical pieces to more contemporary work. It also hosts travelling exhibitions. Al Mahatta Museum - Did you know that Sharjah was home to the first airport in the Gulf? You do now. Al Mahatta explores the history of air travel in the Emirates. Khor Kalba Conservation Reserve - Aside from the museums, Sharjah is also home to a beautiful unspoilt nature reserve - home to plenty of stunning native species. Where am I likely to be working? Al Zahra and Zulekha Hospital are arguably two of the most popular with expats in Sharjah, and both offer high quality facilities. The state owned University Hospital is another option, albeit openings within the public sector are rare, and often struggle to match the salaries paid in the public sector. It’s also possible to work in Dubai and commute, but travelling times during peak hours can be lengthy - so we wouldn’t recommend this. Who is suited to a move? Sharjah is ideal for someone looking to boost their finances, but without the restrictions that can be found in Saudi Arabia. Being located near Dubai means that there is plenty to see and do for all ages and interests, whilst the Emirates’ private schooling system is impressive. If you’re looking for a career boosting move however then locations such as China and New Zealand can provide a better option to enhance your skills, whilst the stifling heat (and unique culture) of the Gulf means that isn’t ideal for everyone. We think that a move to Sharjah suits someone seeking the financial benefits of living in the Gulf, but not someone looking at a longer term move. Why move? There are plenty of reasons to relocate to Sharjah, here are five of the most convincing. Finances - A low cost of living, and tax-free salary packages is a recipe for success. Surroundings - Unlike Dubai, Sharjah still retains plenty of traditional Arabic charm Culture - Sharjah is home to a range of museums, all of which are cheap (or even free) to visit. Weather - Year round sun and heat makes the country ideal for those who hate cold winters and wet summers Healthcare - With land expensive in Dubai and Abu Dhabi, Sharjah is becoming a popular location amongst healthcare providers looking for space and value. For more information about moving to Sharjah, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdqvmtavmjyvmtcvnzyxlze5u2luz2fwb3jltmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Singapore to Ban Sugary Drinks?

It’s been revealed that Singapore could become the first country in the world to introduce an outright ban on sugary drinks. Already known globally for its ban on chewing gum, the country’s Ministry of Health are now seeking views on four proposals targeting beverages packed with excessive sugar. These comprise an outright ban on pre-packed drinks containing more of six teaspoons of sugar, the introduction of a single or tiered tax on high sugar drinks, mandatory front of packing warnings about the sugar content, or a nationwide ban on all adverts for beverages that are high in sugar. At the moment sugary drinks are already banned in schools and government buildings, however with almost half of Singapore’s sugar intake coming from drinks further action is urgently required. Sugary beverages aren’t the only unhealthy lifestyle choice being targeted on the island however, with Orchard Road becoming the first smoke free area in the country. Introduced on January 1, those looking to light-up are now only permitted to do so within designated smoking areas around the precinct. At the moment they’ll only be asked to move to these areas by wardens - however by spring enforcement action will begin to be taken. Citing the success of Scotland’s 2006 smoking ban, and the positive impact of not exposing people to passive smoking, experts are now hopeful that the ban will encourage more people to stub out the habit. Running for over 2.5km between Tanglin Mall and Dhoby Ghaut Metro Station, the scheme could be a prelude to a much larger nationwide ban. Singapore is home to one of the most dynamic and forward thinking healthcare sectors on the planet. As a result job opportunities are infrequent, and employers are always looking for the highest quality of candidate. To get ahead of the rest register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdqvmtavmjevmjcvnjcylze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Saudi King Passes Health Reforms

Saudi Arabia’s King Salman has given royal approval to a number of changes in healthcare policy, including the establishment of a new centre focused on evidence based practice. Whilst the new facility dominates the headlines the King has passed a range of new suggestions made by the Saudi Health Council, aimed at further developing the already strong sector for 2019. A national registry of tumours is to be introduced, ran by the Saudi National Oncology Centre. It is hoped that this will allow the prevalence of Cancer to be easily monitored, with all hospitals and clinics in the Kingdom asked to work collaboratively in an attempt to reduce rates of the condition. Further to this, new laws will make it mandatory for all hospitals with appropriate facilities to receive heart attack patients transferred by the red crescent, whilst standardised laboratory measurements will be used nationwide for the very first time. Secretary general of the Saudi Health Council, Dr Nahar Al-Azimi, thanked King Salman for supporting the group’s decision. He said: “The approval reflects King Salman and Crown Prince Mohammed bin Salman’s keenness to improve the quality of life of people of Saudi Arabia. “Regarding oncology services in the Kingdom, specialised hospitals and medical cities have been directed to activate a hub-and-spoke cooperation program. This will be implemented in two phases. “In the first phase, oncology units in Arar, Madinah and Asir will be linked to specialised hospitals, and in the second phase, specialized hospitals will provide other health facilities with studies and relevant work plans.” Would you be interested in a move to the unique and historic Desert Kingdom in 2019? Register on our website today for job alerts, a dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdqvmtavmtcvmdgvodi4l09kexnzzxlhdwlkzvblcnrolnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to...Perth

Perth is the largest city in Western Australia, and one of the biggest in the country. Often described as the world’s most remote city - it sits more than 2,100 kilometers from the next nearest Australian city, Adelaide. Perth is a vibrant hub, flanked by attractive suburbs and miles of stunning coastline. Who is suited to a move? Relocating to Australia is ideal for a medic with a decent wedge of experience back home, but with a desire to take their skills overseas as part of a long-term move. The country is fantastic for raising a family and, unlike some locations in the Gulf and Asia, many people make a move from Europe and don’t return. Perth is home to a relatively young workforce, and as a result there are plenty of opportunities for recently trained medics. After three, four of five years experience in your homeland you should be ready to make a real impact. If you’re looking to leave Britain, Europe or America behind for good, but don’t want a totally alien culture, then Australia (and Perth especially) is probably an ideal location. What is there to do? Perth has plenty of attractions, but here are three of the most popular. The Art Gallery of Western Australia - For fans of both traditional and contemporary art, the Art Gallery of WA is home to one of the finest collections in the country. Having first opened its doors in the late 1800s it is one of the most historic galleries in the country, and that is reflected in the rich collections on display. King’s Park and Botanic Garden - If you’re moving to Australia you’ll want to spend some time outside, enjoying the great weather and stunning scenery. Where better to do that than in King’s Park? Located near the main business district of the city, it’s an oasis of calm that can feel like another world. The WACA - Cricket seems to be a very popular hobby with many of our candidates, and in Australia it’s part of everyday life. The world renowned WACA isn’t just an impressive stadium either, it’s also home to a museum looking at the history of the sport - and others - in Western Australia. Where am I likely to be working? For some cities and towns this is easy to answer. There are often only a small number of high quality medical facilities, and so it’s easy to pinpoint the main hospitals and clinics. In Perth this isn’t the case however, with a vast array of hospitals, clinics, health centres and GP surgeries all operating to a high standard. If recent trends are to be replicated however, we’ve seen a large demand for General Practitioners in the area. Almost exclusively these roles are within neighbourhood practices - based out of the city centre in the smaller suburban towns. Where to live? Perth has plenty of attractive places to live, from modern apartments in the heart of the city, to spacious villas in quiet suburbs. Where you’ll work will probably decide where is best for you to live, but the city’s strong infrastructure makes it relatively easy to commute into the heart of the city from anywhere nearby. East Perth was recently named as Australia’s most lifestyle friendly suburb, mixing green space with a quick and easy commute to the city centre. Prices are high here, and space can be at a premium, so many people choose to look further afield at places like Swanbourne, Ashfield or Highgate. Here prices are considerably lower, allowing you to get more space for your money, whilst commute times remain manageable. Why move? How many reasons to you need for moving to Perth? How about five? The Lifestyle is great. Laid back and relaxed, but with a buzz that other Australian cities can’t match. Perth is home to plenty of job opportunities, especially for General Practitioners. A lower cost of living than many other major cities in Australia - with property prices considerably lower than in Melbourne or Sydney. Last year Perth became the first city in Australia to offer a direct flight to London - making travelling home a whole lot easier. Perth’s architecture and history make it an extremely attractive place to call home. Don’t fear that you’ll be living in the dusty outback, there are plenty of attractive historical buildings, and modern skyscrapers. For more information about moving to Western Australia, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmtivmjcvmtevmtyvntmvnjqvvufftmv3cy5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Cost of Healthcare Rising in UAE

Healthcare costs in the United Arab Emirates are on the rise according to a newly published report. Analysing data from 2017, the cost of medical support in the Emirates rose by 9.9% over the year - a remarkable 20% higher than the increase recorded in Singapore. In the report, published by global investment advisors Willis Towers Watson, medical inflation globally has been shown to sit at around 10% - creating a greater than ever need for more sustainable and managed healthcare solutions. Speaking about the challenges facing the Emirates, Simon Stirzaker, regional health and benefits leader at Al Futtaim Willis, said: “Medical costs in the UAE are clearly rising at an unsustainable rate - if medical inflation continues on its current trajectory then the cost of providing medical insurance benefits will become higher than payroll. “A key part of the problem is that the consumers of healthcare services (workers who are insured) tend to be disconnected from the actual cost of the services they are using. “Despite this The UAE has made significant and admirable progress in the health care sector, particularly in facilitating access to quality health care for its residents. “The challenge now is to build on these achievements whilst controlling costs.” Would you be interested in a move to the UAE in 2019? Register on our website today to start your journey - a dream role could be closer than you might imagine.

W1siziisijiwmtgvmtivmjcvmtevmtivmtuvmtc5lze5q2hpbmfgzwf0dxjllmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Make the Move 2019 - China

It’s at this time of year that many people start considering (or in many cases start re-considering) the idea of a move abroad. A new year brings with it new hopes, a fresh start and the opportunity to do something you’ve been hoping to do for a while. So why not make 2019 the year you finally go for that new life overseas? Over the final five weeks of 2018 we’ve looked at a select group of the countries we work with, and examined why you should make the move in 2019. During this we’ve recapped some of the major news stories from 2018, what sort of person would be suited to a move, and what the future could have in store. In the final installment in the series we’re going to taking a look at China, a global superpower with an exciting future. What made the news in 2018? China has always been fairly cautious when publishing health news and so, unlike many Middle Eastern locations, stories only hit the headlines occasionally. Despite that however we still have plenty to round up from a busy year in the country. This started in April when data from the Lancet showed the scale of China's COPD problem. According to the report almost 100 million Chinese people are now suffering from the condition - a staggering 8.6% of the country’s total population, with the research - which screened the lungs of more than 50,000 participants - considered the most comprehensive ever conducted in the country. During the same month China's pollution rates were also shown to have dropped - although they remain dangerously high in some industrial parts of the major cities - potentially damaging the health of many generations to come. As we moved into Summer, new World Health Organisation data showed that China now tops the UAE in terms of healthy life expectancy for the very first time. We then turned our attention to exclusive features as more and more candidates began to express an interest in working in China. Firstly we looked at five things you should know about Shanghai, before focusing on five things you should experience in the stunning modern metropolis. Cancer took the headlines in August, with care becoming more affordable thanks to a new partnership between the country's state medical supplier, and pharmaceutical giants. The year ended with another duo of features. First we took a look at five things you should know about Guangzhou - an increasingly popular location with expats that is often overlooked in favour of cities like Shanghai, before our 'At a Glance' series took a brief look at every aspect of life in the country. Who is suited to a move? We'd ideally recommend to people who fit two categories. Firstly, experience is vital. You'll be acting as a leader in the country, training up the next generation of local medics and implementing professional techniques department-wide. Secondly motivation is key. A move to China will be hard work, but the impact you can make (and legacy you can leave) will be a great reward. If you're looking for a move purely to enhance your finances, or key to wind down, then we'd recommend looking elsewhere. What does the future hold? This is where China excels. The future looks extremely exciting. China is home to one of the world's fastest growing economies, and with a rapid transition from an industrial to blue collar economy a move is futureproof. If you're looking for long term stability then few locations can rival the Far East - and especially China.

W1siziisijiwmtgvmtivmtkvmtqvmdkvndqvoti4lze5q2fuywrhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Smoking Rates Shock in Canada

For years smoking rates in Canada have been falling. Now however they have started to creep back up, prompting calls for expert assistance. According to the latest statistics 16% of Canadians over the age of 25 now regularly smoke tobacco, a figure that has grown by 3% compared with the previous 12 months. Canadian health officials have worked tirelessly to reduce smoking rates, with the introduction of graphic warnings on packaging, comprehensive education programs from a younger age, and even freephone telephone numbers offering support to anyone trying to kick the habit. Now calls are being made to assess how effective these programs have been, as the country aims to reduce rates nationwide to just 5% by 2035. Research published recently in the United States has shown that mortality rates caused by smoking have actually risen of the last half century - with the use of tobacco not becoming any safer with time. In a statement Health Canada defended their current policies, and highlighted that a review wasn’t related to any failures. It read: “The government of Canada is committed to evaluating our programs to ensure that we are delivering value to Canadians. “This ‎contract is intended to bring in experts to help us evaluate the value of the previous tobacco strategy, and the benefits it has delivered to Canadians. This is a standard part of regulatory and policy development. The results of this evaluation will inform future strategies and policies.” Canada has been a popular location for expats seeking a better life overseas for many years now. To find your perfect role register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtivmtkvmtqvmdqvntyvodgvmtlhdwxmrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

'Diabesity Epidemic' in the Gulf

Shocking new figures have shown that the number of diabetics in the Middle East and North Africa (MENA) region will grow by 110% by 2045. According to the statistics, published ahead of January’s Arab Health summit, only Africa is set to see a higher growth in the percentage of people battling the condition - with it projected to rise by a staggering 156%. Diabetes is already a major issue in the Middle East, with the region home to some of the world’s highest rates of the condition. Kuwait, Qatar, Saudi Arabia, Bahrain and the UAE already have some of the highest prevalence rates globally - with the economic burden expected to reach $35.5bn by 2045. This, along with skyrocketing obesity rates, has been called the Gulf’s ‘Diabesity Epidemic’, and experts have been quick to highlight the major reasons for the issues. Hyper-urbanisation has created an environment built with transportation, not pedestrians in mind, whilst traditionally sedentary lifestyle are now being compounded by unhealthy diets and an increasing reliance on sugary treats and junk food. Speaking about the issues, and his hopes for the upcoming conference, Arab Health Exhibition Director, Ross Williams, said: “With health professionals and researchers considering ‘Diabesity’ as potentially the greatest epidemic in human history, the advancement of communication technology, telehealth and the application of Artificial Intelligence is now playing a critical role in management of chronic illnesses such as diabetes and obesity. “The economic and societal impact of the epidemic is a catalyst for the entire healthcare industry to come together to offer collective solutions to this global problem.” “The Diabetes Conference at Arab Health is the perfect platform to bring together all stakeholders - from government authorities to the region’s leading diabetes experts - to assess the various public health measures and technological advancements that can be adopted in order to tackle the growing burden of this epidemic.” Would you be interested in helping the Gulf in the region’s battle with ‘Diabesity’? We’ve got a rich network of clients throughout the region, meaning that a dream job could be far closer than you might imagine. Register on our website today to start your Odyssey.

W1siziisijiwmtgvmtivmtkvmtqvmdevndevmtgwl1vbruzlyxr1cmuucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Make the Move 2019 - UAE

It’s at this time of year that many people start considering (or in many cases start re-considering) the idea of a move abroad. A new year brings with it new hopes, a fresh start and the opportunity to do something you’ve been hoping to do for a while. So why not make 2019 the year you finally go for that new life overseas? Over the final five weeks of 2018 we’re looking at a select group of the countries we work with, and examined why you should make the move in 2019. During this we’ve recapped some of the major news stories from 2018, what sort of person would be suited to a move, and what the future could have in store. In the penultimate installment in the series we’re going to taking a look at the United Arab Emirates, still the most popular country we work with thanks to its world leading salaries, and high standard of living. What made the news in 2018? It was a typically busy year of health news in the Emirates, with new facilities, studies and achievements regularly making the press. The first major story of the year saw a team of medics from Abu Dhabi's Danat Al Emarat Hospital save the life of a 48 hour old child born with a large Ovarian cyst. Later in the same month it was revealed that patients in Dubai have positive attitudes towards Artifical Intelligence in healthcare, whilst a team at Latifa Hospital in the Emirate saved the life of a child born after just 24 weeks. In March Al Qasimi Hospital in Sharjah became the first in the Middle East to take on the latest generation of robot assisted Percutaneous Coronary Interventional technology, perhaps aided by news that private investment in healthcare was soaring throughout the country. Spring opened with 'Health Pods' introduced in an attempt to identify underlying health issues at an earlier stage, whilst female health took centre-stage at the World Congress on Gynaecology and Obstetrics - with the five biggest health problems facing females in the UAE examined. April was a hectic month, and the news continued with the introduction of AI technology that could help children with Autism. It was then revealed that millionaires in the Emirates believed that their health was more important than wealth, before three obesity related stories concluded the month. The first saw attempts to reduce rates in the country recognised at a conference studying the scale of the issue regionwide, before a new study revealed that children's awareness of what constitutes a healthy lifestyle hit an all time high. Just how big an issue childhood obesity is however was illustrated when it was revealed that Sheikh Khalifa Medical City would offer Gastric Balloon surgery to patients as young as 11, albeit only in extreme cases. May opened with a new partnership giving free healthcare to thousands of expats in the country, whilst the demand for healthcare was also hitting record highs. Later in the month we took a special look at new Visa laws in the country, which were great for expats seeking a long-term move to the Emirates. In June a new report illustrated just how impressive the UAE's development in recent years has been - with life expetancy rising by six years nationwide. Perhaps this figure will rise further in the future, thanks to the introduction of new telemedical technology that makes it possible to visit a GP on your phone. Elsewhere it was revealed that secondary infertility rates had risen notably - potentially leading to a decline in population numbers in the future. Technology was back in the news in July, with Virtual Reality advancements helping stroke patients in the UAE to recover. Plans were also revealed for a star-rating system to be introduced for hospitals in Dubai. August was an equally as busy month, with a report praising the Emirates' healthcare system as the best in the Middle East. It was therefore little of a surprise that the UAE (and Saudi Arabia) came ahead of a host of countries (including the United Kingdom) in a report into the wellbeing of the nation. It was also revealed that fewer people than ever were leaving the UAE for medical treatment overseas. The month ended with rare surgery being carried out in Ras-Al-Khamaih to restore the sight of a patient suffering from optic neuritis. As summer became early Autumn, King's College opened a new facilitity based beside Dubai's stunning marina, shortly after a Tuberculosis awareness campaign was launched nationwide - with the aim of totally erradicting the condition. In October another campaign was launched, this time aimed at increasing awareness around the causes of hypertension - and issues relating to it, whilst a month later Breast Cancer was placed in the spotlight. The year concluded with great psychiatric care being offered under the basic healthcare package, with the UAE following global trends in noticing a sharp rise in the number of patients seeking mental health support. Who would be suited to a move? The UAE really is ideal for anyone, but ideally we'd reccomend it to someone with a reasonable degree of experience. Working in the UAE can be quite an independent experience where you will rely on strong problem solving skills, and so it is ideal for someone with more than five years post-training experience. With plenty to do, and the safety and security of compound living, the country is ideal for people with young families. What does the future hold? For now things look fairly secure, with healthcare being seen as the key to driving the economy away from a reliance on oil. This might not be the case longer term however - so if you're looking to spend the rest of your life overseas, the UAE is probably not the ideal location.

W1siziisijiwmtgvmtivmtivmtmvmzkvndmvodu4lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

OECD: Australians in Good Health

A new report has shown that Australians are in relatively good health, despite higher than average rates of Cancer and alcohol consumption. Thanks to a recently released online tool compiled by the Australian Institute of Health and Wellbeing (AIHW) it’s now easier than ever to compare Australia’s figures with other OECD nations, and the global average. The figures show that the perceived health status of the nation was the fourth best globally, whilst the country ranked second only to Belgium in the number of long-term care recipients in institutions other than hospitals. It wasn’t all positive however, with Australia well above the OECD average of overweight and obese adults - with rates now at 63.4% compared to 58.1% globally, whilst world leading Japan has obesity rates of just over 25%. Alcohol consumption rates were also higher than average - with Aussies now consuming 9.7 litres per person. Australia also had the world’s second highest Cancer prevalence rate, with 323 out of every 100,000 people facing the condition - a figure well above the global average of 269.3 per 100,000. Thanks to its universal healthcare system Australia was joined by a host of other countries (including New Zealand, the UK and Finland) in having 100% healthcare coverage, whilst the country also had a higher than average uptake for private health cover. Speaking about the survey, and especially the higher than average Cancer rates, Claire Sparke, AIHW spokesperson, said: “We may have higher incidence but we also have higher rates of survival. “The chances of cancer by the time you’re 75 are one in three. If you make it to 85 it’s one in two.” Is a move to Australia something that would interest you? We have a few opportunities available our website - meaning that a dream move could be closer than you might imagine.

W1siziisijiwmtgvmtivmtivmtmvmzavmdcvodkvmtlpzhlzc2v5rxhjbhvzaxzlrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Make the Move 2019 - Australia & New Zealand

It’s at this time of year that many people start considering (or in many cases start re-considering) the idea of a move abroad. A new year brings with it new hopes, a fresh start and the opportunity to do something you’ve been hoping to do for a while. So why not make 2019 the year you finally go for that new life overseas? Over the final five weeks of 2018 we’ve looked at a select group of the countries we work with, and examined why you should make the move in 2019. During this we’ve recapped some of the major news stories from 2018, what sort of person would be suited to a move, and what the future could have in store. In the third installment in the series we’re going to taking a look Australia and New Zealand, two countries that can offer a great standard of living, work/life balance and world leading medical facilities. What made the news in 2018? It was a seriously busy year of news in both Australia and New Zealand, with mental illness especially of concern. This was the case from early January, when the Australian Royal Flying Doctors Service highlighted the major issue of mental health in hard to access rural locations. The same month a report illustrated another serious problem, that Australian men were consuming twice the amount of salt considered safe on a daily basis by the World Health Organisation. Processed food was given much of the blame, with many people unaware of just how unhealthy these can be. After a quiet few months lifestyle related health was in the news again in April, with calls made for cigarette style warnings to be placed on alcohol packaging. In the same month a new survey revealed that a third of office workers in Australia were battling mental health concerns. Spring proved a busy time, with New Zealand marking World Asthma Day by providing those working in education with a 'Teachers' Toolkit' to help deal with any asthma emergencies. Mental illness was back in the news come May, with a survey revealing that there was a 46% increase in young people visiting Emergency departments in Victoria between 2008 and 2015. A week later Melanoma was named as Australia's 'National Cancer' - with 17% of people in the country considered to be at a very high risk. As we moved into summer, shocking new statistics suggested that a third of Australians were unware of some of the rarer health conditions caused by smoking, such as female infertility, Kidney Cancer and Diabetes. Later that month, and in an attempt to fightback against concerning rates of mental illness, New Zealand announced a $10m pilot scheme, which would provide young people in the country with free mental health councilling. The country also went on to announce plans to base psychologists in GP clinics. In August the news agenda changed, with a switch to dentistry - particularly New Zealand's school dental system, after statistics showed that Kiwi schoolchildren were having on average 100 having teeth removed every day. The focus switched back to mental health at the end of Summer, with new statistics showing almost 70% of women in Australia feel anxious or nervous every month. Shortly after, calls were made for a reform of mental health services in New Zealand, with suicide rates in the country increasing by 10% over the course of a year. A busy period of mental health news ended with Australian GPs revealing that it was the most common issue they dealt with only a daily basis. As we reached Autumn it was revealed that Australia is unlikely to hit a WHO target for the reduction of chronic disease, leading to further calls for a 'Sugar Tax'. Mental health returned to the agenda in October, and this time it was New Zealand's rural crisis that was holding the headlines. Research then published in Australia illustrated a direct link between mental health and wealth - with income having no major impact on physical health, but a notable one on psychological issues. The year ended with a focus on maternal health, as it was revealed that more women than ever are now opting for Caesarean Sections in Australia. Who would be suited to a move? Both Australia and New Zealand can be well suited to a wide range of people, from young medics looking for great roles at the start of their careers - to experienced professionals keen to take their skills elsewhere. Out of every group though, we think both countries are perfect for younger medics with experience looking for a long-term move. What does the future hold? Both countries offer stable political climates, whilst funding for healthcare is sustainable and well thought out. As a result, more of the same carefully planned growth in healthcare looks set to be the case for quite a few years to come.

W1siziisijiwmtgvmtivmtivmtmvmzuvmzgvmja3lze5vmlldg5hbu5ld3muanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Liver Cancer Rates Soar in Vietnam

Liver Cancer has overtaken Lung Cancer to become the most prominent type of the condition in Vietnam. It marks the first time in history that rates of the issue have topped national trends in the country, with new figures from ‘Globocan’ showing that 25,334 people contracted Liver Cancer this year, compared to 23,667 who were diagnosed with Lung Cancer. Both rates are extremely high globally, with only Mongolia and Egypt having higher Liver Cancer rates. Inequalities were also clear between men and women - with males three times more likely than females to succumb to the condition. A range of reasons have been given for these extremely concerning figures - but seriously high rates of alcohol and tobacco use look like being the biggest issues. Vietnam has one of the world’s highest smoking rates, with over 16% of the country’s total population smoking on a regular basis. Further to this is the country’s growing alcohol consumption rates - which are some of the highest in Asia. Annually the average Vietnamese adult now consumes 8.3 litres of alcohol a year - considerably more than the likes of China (7.2l), the Philippines (6.6l) and Singapore (2l). Greater education around the risks of excessive tobacco and alcohol use now looks as if it could be the key to reducing both figures, however with rates rising sharply acting quickly could be the key. We occasionally have roles on offer in Vietnam, and with the country’s healthcare market growing quickly we’re expecting it to become increasingly popular in 2019. To get ahead of the rest, register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtivmduvmtqvmdqvmdqvnzcwlze5r3vszkzlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

FAO: Locums in Saudi Arabia

Have you recently taken up a short-term locum in Saudi Arabia, or is it something that you’re considering? If so then we have some important information to avoid finding yourself in a tricky situation. Unlike most other locations, Saudi Arabia’s Ministry of Health only starts the process of registering you once you’ve arrived in the Kingdom. Once granted, the issue date is backdated to when you first arrived and everything continues as normal. This approach can cause issues for medics taking up short-term (under three month) locums however. Things move slowly in the Desert Kingdom, especially administrative tasks, and so it isn’t uncommon for the registration procedure to take more than three months during busy times or holiday periods. Medics can therefore leave the country before the formalities are complete, putting them in a difficult situation if they return to the United Kingdom and attempt re-register with the GMC. Without a record of registration with the Saudi authorities they have to declare that any work has been carried out illegally - despite this simply being a quirk of the system. Not only will you be unable to apply for accreditation until the paperwork is sorted, it can also damage your reputation. So what can be done? The easiest way to get round this is by ensuring that you don’t leave the country without the backdated registration complete. This will make sure that you avoid any difficulties or unnecessary stresses when re-applying to the GMC. Alternatively - and only in extreme cases where you’ve had to leave without being able to check that the paperwork is complete - you can remove it from your CV, and say that you had taken a career break or holiday. Again this gets round the issue, but we would always recommend doing things by the book. If you haven’t done either, then it becomes a waiting game. You’ll need to stay in regular contact with the Saudi MoH and ensure that they sort everything at their end. This can be a frustrating process however, especially if you’ve got another move lined up, so it’s easier to make sure that everything is tied up prior to your return.

W1siziisijiwmtgvmtivmduvmtmvmjavmjgvodyxlze5s1nbrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Make the Move 2019 - Saudi Arabia

It’s at this time of year that many people start considering (or in many cases start re-considering) the idea of a move abroad. A new year brings with it new hopes, a fresh start and the opportunity to do something you’ve been hoping to do for a while. So why not make 2019 the year you finally go for that new life overseas? Over the final five weeks of 2018 we’ve looked at a select group of the countries we work with, and examined why you should make the move in 2019. During this we’ve recapped some of the major news stories from 2018, what sort of person would be suited to a move, and what the future could have in store. In the second installment in the series we’re going to taking a look at Saudi Arabia, a country that can offer world leading salaries and a unique cultural experience. What made the news in 2018? It was another busy year of healthcare news in the normally secretive 'Desert Kingdom' - although it took until May for the major stories to start flowing, As Spring started to become Summer, research showed a sharp rise in the number of people excercising at least once a week - which had grown from 13% in 2015 to just under 25% by the end of 2017. A large chunk of this success was put down to the Saudi General Sport Authority (GSA) who introduced neighbourhood football leagues, community sports groups and organised the Riyadh Marathon. May and June is always a fascinating time in the Gulf, as the region effectively shuts down to observe Ramadan. This can have a huge impact on everyday life, so we compiled a quick guide looking at what to expect if you're living there. The month concluded with two stories in consecutive days. First a report said that Saudi will require an additional 20,000 hospital beds by 2035, before we took a look at five culture shocks you should prepare for if you choose to move to the Kingdom. A fortnight later Dubai based healthcare giants NMC sealed a deal that made them the second largest healthcare providers in Saudi Arabia. The value of the nation's healthcare market was also estimated to hit $30bn by 2022. Further good news came in a report published at the end of July, which stated that 95% of the Saudi population are generally in good health, whilst a quarter of the adult population went for regular check-ups. It wasn't all positive though, with rates of chronic conditions (especially amongst women) remaining high. Whilst Saudi Arabia isn't for everyone, it certainly has plenty to offer - and so in August we took a look at five of the biggest attractions to the Kingdom. Unlike in other guides however we've totally ignored the financial benefits of a move. August was a busy month in the country, with a global report naming the Saudi Healthcare system as one of the most efficient globally - coming in just six points behind Singapore. As Summer became Autumn the efficient healthcare sector was also named as the largest in the Middle East - boasting world class facilities and talent. Saudi Arabia would also top another report - but this one was less positive - as it was named as the country with the world's largest market for Diabetes, with a quarter of the population now believed to be battling the condition. Shockingly 13% of diabetics in the region are also believed to be undiagnosed. News of the markets growth continued to spread as the year came to a close. 178,000 more beds will be required by 2050, with the country's population set to grow and age significantly over the next 30 years. That strain might be eased by a huge deal however, with Hassana and NMC Health concluding a £1.2bn agreement to develop a new network of facilities nationwide. Who would be suited to a move? Saudi Arabia certainly isn't for everyone, but it can suit most people - if not for a long-term permanent relocation. Most people moving to Saudi Arabia can be split into one of two groups. Either they are going for a fixed-term for financial gains, or they are looking to be in a more familiar environment that is close to their home nation - but financially rewarding. As such we think the country is ideal for Muslims with a background in the Middle East. This will lead to little culture shock, and these people will be comfortable with how ingrained Islam is in everyday life. It can also provide a fascinating cultural experience for expats who have worked globally before however, especially those with a solid background in medicine and a desire to experience something different. With the high cost of education and restrictive lifestyle, we wouldn't recommend it for families with teenage children. The safe, friendly compounds can be great for younger children however - especially if a move is only for a short period of time. What does the future have in store? Saudi Arabia has been built on an oil-driven economy, however as the world begins to move on so too has the Kingdom. Building one of the Gulf's best healthcare sectors is a key aim, and with generous funding and a passion for the highest possible quality, a move should be relatively futureproof.

W1siziisijiwmtgvmtivmduvmtmvndivmjmvmty5l1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Flu Rates Soar in UAE

The UAE has reported a far higher than average demand for the flu vaccine, after an unexpected increase in the number of cases already this winter. This has lead to a shortage of the vaccine in the Northern Emirates of Sharjah, Dubai, Ajman and Ras, with waiting times for appointments in some clinics now stretching for a couple of weeks. Abu Dhabi appears to have bucked the trend, with vaccines available at plenty of facilities - and rates remaining more settled than elsewhere. Speaking to the Khaleej Times about the flu season, internal medicine consultant at Burjeel Day Hospital, Dr Fadi Baladi, said: “People start thinking about flu between the end of September and early November, and at that time we are vaccinating tens of patients each day. “Recently though more patients have been coming in for the flu vaccine as a result of more news about people becoming unwell.” This year flu has already lead to two deaths; one involving a 17 year old student, and another in the case of a nine year old schoolgirl. Currently the UAE’s Ministry of Health recommends the flu jab to everyone over the age of six months, without allergies to any of the vaccines components. Special priority is given to those with underlying health conditions (such as heart disease, asthma and diabetes), as well as the elderly and pregnant women. It costs around Dh60 (£12), but with demand high anyone in a risk group who hasn’t yet been vaccinated is urged to book an appointment as soon as possible. Would working in the UAE interest you? We’ve got a range of roles on offer on our website, so register with us today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtevmjgvmtivmjqvmzevndk5lze5q2fuywrhrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

test video

test video text

W1siziisijiwmtgvmtevmjgvmtivndavmdevndy0lze5qxvzdhjhbglhrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Mental Health Young Australians' Biggest Issue

Mental health is the biggest issue facing young Australians in 2018 according to a newly released report. Data published in Mission Australia’s annual youth survey has shown that 43% of people between the ages of 15 and 19 believe that mental health is the biggest issue in the country. Remarkably this figure has more than doubled over the past three years - with concerns now 14% higher than those around drug and alcohol abuse. Mental health was also highlighted in the personal concerns section of the report, with stress (43%) and mental illness (31%) identified as the first and third biggest individual worries respectively. As a result of their findings, Mission Australia - one of the largest charitable providers of community services in the country - have recommended the introduction of universal evidence based mental health programs, along with greater access to support networks for young people. The organisation’s state director for New South Wales, Victoria, and Capital Territory, Nada Nassan, stressed how important it was to respond to the findings. She said: “As a priority we must ensure that this increased awareness goes hand-in-hand with adequate access to the right help when needed. Access to appropriate and timely support can make a real difference in a young person’s life. “We must see more investment in evidence based programs that promote mental health and wellbeing in schools, as well as holistic support for young people that meets a range of needs during adolescence; such as assistance with school or study problems and coping with stress.” Could you help Australia in the country’s battle with mental illness? If a move would interest you then register on our website today - a dream role could be closer than you might imagine.

W1siziisijiwmtgvmtevmtkvmtmvntavmzivntaxlze5r3vszkzlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

HSBC Expat Explorer 2018 - Part 2 - The Gulf

HSBC has published the results of its annual ‘Expat Explorer’ survey, with Singapore once again leading the way as the most popular location for expats globally. In the second of a two part special we’ve examined the results from the Gulf region - the most popular with medics seeking a more rewarding career overseas. Part One is Available Here Bahrain - 5th (+4) Surprised? You shouldn’t be. Bahrain is one of the Gulf’s hidden gems - bringing together a relaxed island mentality with traditional Arab culture. Expats Loved Bahrain was considered the best location globally for wage growth The country scored highly across all financial indicators The high quality of childcare and educational facilities An open and tolerant society The outstanding work/life balance How safe the country was for families Expats’ Downsides The cost of childcare was high Compound living made integration difficult Traditional food and a lack of fitness facilities saw a move have a detrimental impact on expats’ health The heavily westernised culture United Arab Emirates - 10th (-3) The UAE remains a firm favourite with expats, even if it has slipped three positions over the past 12 months. Expats Loved A move had a hugely positive financial impact The country’s stable government and increasingly liberal laws earned praise The UAE was rated as one of the world’s safest locations The Emirates are great for entrepreneurs The quality of childcare and education is extremely high Expats’ Downsides There are few remnants of traditional culture - especially in the expat hubs It was expensive to raise children Expats found it very difficult to integrate into society Saudi Arabia - 26th (+3) Saudi Arabia rises, but remains in the lower half of the table. Expats Loved 2nd best location in the world for enhancing savings 4th best for wage growth Job security was high, with many people working within vital industries The country’s impressive healthcare system scored well The value for money and standard of accommodation on offer Expats’ Downsides Expats found adapting to the country’s culture difficult A move wasn’t great for career progression With little entertainment on offer expats said that their social lives suffered Interested in relocating to any of the locations mentioned in this article? Register on our website for job alerts today. A life changing move could be closer than you might imagine.

W1siziisijiwmtgvmtevmtkvmtmvntgvmtuvmzy0l09tyw5ozxdzlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Oman News Roundup

Fertility Rates Continue to Drop Oman’s fertility rate is continuing to drop, with a new United Nations report showing that it currently sits at 2.7 births per woman. Whilst this is still considerably higher than in the West, where rates in Germany and the United Kingdom range from 1.5 to 1.8, it represents a staggering drop since 1980, when the average Omani woman gave birth more than eight times. The report shows that women in Oman now have greater freedom - with the Sultanate’s Government pleased about the impact a lower number of children will have on educational facilities. Speaking on behalf of the United Nations Population Fund, Asr Ahmad Toussoun, explained the positive impact a lower birth rate can have. He said: “Birth spacing and the empowerment of women drive the pace of economic and social progress in the world.” Boost for Thalassemia Patients A joint partnership between the Omani Ministry of Health and Novartis is set to bring the latest iron-overload treatments to the Sultanate. Government data suggests that as many as 75% of patients visiting clinics have an inherited blood disorder - with sickle cell disease, thalassemia and glucose-6-phosphate dehydrogenase the most common. Now the MOH and Novartis, who launched their first iron-overload medication back in 1968, have made new film-coated tablets available - making treatment quick and convenient. The new partnership is just one of many ways that the Omani health ministry is attempting to deal with Thalassemia - with premarital screening already widespread, and work to reduce the traditional attitudes towards the issue also underway. Mandatory Health Insurance to be Introduced Oman is set to follow regional trends by introducing mandatory health insurance for workers in the country. According to a recent article in ‘Muscat Daily’ preparations are already underway for the introduction, which would see the country follow the likes of the United Arab Emirates by making insurance mandatory. Oman’s approach has been typically meticulous, with the Ministry of Health creating a team of experts to create regulations that a perfectly suited to the market conditions. Rumours suggest that insurance could be mandatory as early as next year. Interested in a move to Oman? We currently have a couple of openings on our website - register today and start your Odyssey.

W1siziisijiwmtgvmtevmtkvmtqvmduvndmvnduvmtlhbg9iywxozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Diabetes Rates in the Gulf Could Double

Experts have called for even stricter laws on junk food and greater promotion of healthy lifestyle choices to prevent diabetes rates hitting epidemic levels in the Gulf. Current trends suggest that the number of people with the condition in the Gulf could more than double over the next 25 years - with researchers from the International Diabetes Federation slating the region’s lack of urgency. The one exception was Saudi Arabia, where more than 4 million people are estimated to have the condition. In an attempt to combat this, heavy taxes have been introduced on sugary treats, whilst a focus on prevention over cure care has been introduced to prevent a future health crisis. Figures suggest that the Middle East and North Africa region is home to over 40 million diabetics - with five out of the top ten countries for diabetic prevalence being in the region. A range of geographical, developmental and social factors have been given for this world leading figure, with hot climates, poor pedestrian infrastructure, traditional diets and a lack of exercise all playing a major role. This makes attempts to reduce the rise in Diabetes rates to 0% by 2025 appear impossible, with only four countries globally on track to achieve the goal. Could you help the Middle East in its battle with Diabetes? Register on our website for job alerts today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmtevmtqvmtqvmdevmzqvoduyl2v4y2x1c2l2zufnr1bldc5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

HSBC Expat Explorer 2018 - Part 1

HSBC has published the results of its annual ‘Expat Explorer’ survey, with Singapore once again leading the way as the most popular location for expats globally. In the first of a two part special we’ll examine the results from around the world, with part two focusing exclusively on the hugely popular Gulf region. Singapore - 1st (-) Singapore retains its crown as the most popular location for expats worldwide, scoring highly in almost all of the 30 outcomes studied. Expats Loved Singapore’s high quality schools - rated as the best in the survey The stable political climate The positive impact a move had on their careers The high quality, modern healthcare system Singapore was rated as one of the safest countries in the world The financial security of a move Expats’ Downsides High quality childcare and education comes at a cost People found it difficult to integrate and make friends The work/life balance couldn’t rival Australia or New Zealand New Zealand - 2nd (-) New Zealand has remained in second place, despite its remote location, with expats continuing to love life in the country. Expats Loved New Zealand’s healthcare system was rated as the best in the world Expats also loved the impact a move to the country had on their health The country’s famous work/life balance continued to impress The financial security of a move was world leading The stable political climate created plenty of opportunities for entrepreneurs Expats’ Downsides Don’t expect a move to be hugely financially lucrative Finding the perfect accommodation at an attractive price was troublesome Expats also didn’t rate the social experience, with many working in small, rural towns Canada - 4th (-) Joining Singapore and New Zealand in an unchanged position is Canada, considered by many to be one of the world’s friendliest countries. Expats Loved Canada’s extremely tolerant and inclusive society They found the country great for entrepreneurs The high quality of living How easy it was to integrate into society The financial security Expats’ Downsides Despite the inclusive society, expats found it difficult to make friends This was also reflected in a lower than average social life score The high cost of living (especially in the cities) made a move less financially rewarding than one to the Gulf Australia - 6th - (-1) Australia drops one position, but remains comfortably inside the top ten in HSBC’s 2018 report. Expats Loved The high quality of life for them and their families The positive impact a move had on their physical and mental health How easy it was to integrate into society The country’s well structured healthcare system Expats’ Downsides The cost of raising children was high A move didn’t enhance their savings The quality and variety of property available was not as extensive as elsewhere Vietnam - 19th - (+4) Vietnam continues to impress, as one of Asia’s newest success stories. Expats Loved Nowhere in the world was better for boosting your savings The country’s low cost of living was great for someone seeking to maximise their disposable income Expats found making friends easy They were also very impressed by the standard and value of accommodation Expats’ Downsides The country’s busy cities weren’t the best environment for those seeking a healthy life The quality of healthcare in all but the top private facilities was sketchy The same was said about the quality of educational facilities China - 27th - (+3) China continues to rise, however polluted cities and a shy native population mean that it remains at the lower end of the list. Expats Loved A move was great for career progression Expats also found it surprisingly financially lucrative The quality of education was amongst the highest in Asia A move came with a great deal of long-term economic security Expats’ Downsides A high paced working environment lead to a poor work/life balance Expats found integration difficult Expats also found tolerance levels far lower than elsewhere in the world Remember and check our website next week for part two - looking at the Gulf region. Would you be interested in a move to any of the countries in this list? Register online today for job alerts - a dream move could be closer than you might imagine.

W1siziisijiwmtgvmtevmtqvmtqvmdgvndcvnzy1lze5r2xvymfstmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

$778 Million Generated at Arab Health 2018

It has been revealed that exhibitors at this year’s Arab Health expo generated more than $778 million worth of business. The annual showcase, which brings together more than 4,000 businesses from over 160 countries, appears to be following projected trends in the region - which estimate that healthcare spending will rise by $28bn to $104.6bn by 2022. Studies have shown that the demand for healthcare throughout the Middle East and North Africa region will soar in the coming years, with 13,000 more hospital beds and 10,000 medical staff required region-wide over the next decade. As a result hopes are high that the 2019 expo could have an even bigger impact. Taking place between January 28 and 31 at the Dubai World Trade Centre, it will welcome some of the world leaders in medical technology, as well as playing host to 11 CME accredited conferences and more than 250 expert speakers from around the world. More than 80,000 medics are expected to attend over the four days, making it a great opportunity to network for anyone either working overseas already, or considering a move to the MENA region. Exhibition Director, Ross Williams, is positive about the role the event can have in enhancing the future of healthcare. He said: “Some of the key factors stimulating the growth of the healthcare market in the region include an ageing population, the increasing frequency of non-communicable diseases, the high cost of treatment and mandatory health insurance. “The trade generated during the last edition of Arab Health is an indication that the private sector is playing an important role in developing the healthcare industry, and we anticipate that these figures will continue to grow in subsequent years.” We have an unrivalled network of contacts throughout the Gulf region, and so if a move to the area is something that would interest you register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmtevmtqvmtqvmduvndevmjg0lze5tlpozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

'Virtual Campus' Plans in New Zealand

A new ‘Virtual Campus’ specialising in rural healthcare could help tackle New Zealand’s skills shortage in the field. Based on existing models in Australia, the proposals have gained the support of the Universities of Otago and Auckland, and the Auckland University of technology, with a new report detailing the structure and plans of the ‘virtual school’. The operation would bring academics from throughout the country together via a ‘virtual campus’, with students experiencing the real world of rural medicine within small towns. According to research published by the Universities, people living in rural towns in New Zealand have far poorer health outcomes than those in cities - with life expectancies notably lower. Healthcare leaders in the country now hope that they can improve the situation, by training more students in rural healthcare at an early stage. They are also keen to encourage a more collaborative approach, where medical students work alongside nurses, pharmacists and physiotherapists in the community. According to the plans the new facility would; “not (be) an additional tertiary education provider but an 'enabling body' collectively owned by the existing institutions that, by sharing human, physical and other resources, would permit them to educate students in rural communities in ways currently not possible.” They add: “Rural healthcare is more generalist, less resource intensive and more engaged with the community. The boundaries between primary and secondary care and between professional groups are more blurred. “Up until now, most rural health workforce initiatives have come out of individual urban tertiary institutions, and are aimed at single professional groups.” Are the plans a good idea? Let us know your views on our social media pages. Would a move to work in rural New Zealand appeal to you? With a shortage of specialists there are plenty of attractive job opportunities out there. Register on our website, a dream role could be far closer than you might imagine.

W1siziisijiwmtgvmtevmdcvmtmvmzcvmdyvmzk0lze5u2luz2fwb3jltmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Singapore Unites Against Diabetes

Singapore’s Government has unveiled plans aimed at tackling growing diabetes rates in the country. Made public by Health Minister Gan Kim Yong on World Diabetes Day (November 4), the new scheme is focused on integrating healthy decision making into everyday life for Singaporeans. Yong told a press conference: “The War on Diabetes has provided us with a strong foundation to do more and do better in terms of health promotion. “Besides improvements in terms of healthier food quality and more physical activity, we need to better integrate, coordinate and scale up efforts to infuse health into every aspect of Singaporeans’ lives “The task force will focus on the ‘three ‘E’s’ that will contribute towards infusing health into various aspects of our lives. These are changes to our living environment, empowerment of individuals through technology, and engagement of our communities with better service delivery and programming.” Organised with the secretaries for transport, education and manpower, social development and home affairs, public consultation sessions will be held from January until May next year, asking citizens for advice on promoting healthy lifestyle changes. Authorities have already successfully implemented plans aimed at improving diets nationwide, with more than 6,500 stalls and cafes now offering at least one healthier option on their menu. Chairman of the new task force, Amrin Amin, highlighted how important it is not to underestimate the scale of the challenge. He added: “Improving the health of all Singaporeans is a massive effort that cannot be solely undertaken by any single agency. It also needs the support of the private sector as well as the community. We hope that the task force’s work will make significant strides towards transforming the health landscape.” Job opportunities in Singapore are rare and highly sought after. To get ahead of the rest register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtevmdcvmtmvmzivmzyvodq1l1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Greater Psychiatric Care in Dubai

Mandatory health insurance in Dubai will now offer greater mental health support, after the need for more coverage was highlighted during Mental Health Awareness Week last month. Many insurers only covered mental health emergencies when packages were tailored to an individual's’ demands, with Dubai Health Authority's basic plan - used by many low earning workers in the country - offering absolutely no psychiatric services. That is set to change however, with senior health officials confirming that mental illness is an area where improvements are needed. CEO of the Dubai Healthcare Corporation (DHC), Dr Younis Al Kazim, said: “Mental health is going to be part of the public health strategy. We cannot ignore it as it is important in providing stability to an individual at home and at the workplace. Many a time, patients from the Intensive Care Unit who may have suffered a cardiac episode can be affected psychologically, and live in fear of losing their life. “We have had several cases of patients going into depression once they were discharged, making it difficult for them to reintegrate into the community and be productive. Now we are working to have mental health included in health insurance. The patients will receive psychological counselling along with associated ongoing treatments.” Gradually the stigma around mental health conditions is dropping, however in many Arab countries - where traditional attitudes remain - there is still plenty of work to be done. Could you help the UAE in its battle with mental illness? If you think a move to the country could be the next step in your career register on our website today. A dream role could be far closer than you might imagine.

W1siziisijiwmtgvmtevmdcvmtmvmjevmjevmja4lze5t2r5c3nleuv4y2x1c2l2zuzlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Your Odyssey - Australasia

Covering a large area of land and sea in the Southern Hemisphere, Australasia's two main countries are Austalia and New Zealand. Both are popular with medics seeking a more rewarding career overseas, especially those looking to escape from the NHS. Here's a quick guide to the area - and the provinces and states we have recently had roles available in. (Simply click to enlarge) Australia Population24.6 millionSize by Area7.692 million km²Birth Rate1.81 per womanDeath Rate7.3 deaths per 1,000Biggest KillerCerebrovascular diseaseGDP Per Capita$53,799 (USD)Capital CityCanberra New Zealand Population4.794 millionSize by Area268,021 km²Birth Rate1.87 per womanDeath Rate7.5 per 1,000Biggest KillerHeart DiseaseGDP Per Capita$42,940 (USD)Capital CityWellington Major Health Issues Mental Illness Mental illness prevelance globally is on the rise as the stigma is lost and people become more aware of their mental wellbeing. Australia does not buck the global trend. Around 1 in 5 ‘Aussies’ experience the symptoms of a mental health disorder every year. Anxiety is the most common mental illness in the country, affecting 14.4% of those battling issues, whilst depression was one of the country’s leading causes of suicide. Likewise in New Zealand, the suicide rate is also continuing to rise - especially amongst men. A male in New Zealand is more than three times more likely than a female to commit suicide, with it now being one of the main causes of male deaths in the country. In 2015 there were roughly 3,027 deaths by suicide, of which 2,292 involved males. That figure was a notable rise on 2014, where it was given as the cause of 2,864 deaths. Both Governments are attempting to fight back, however even with their support it looks like a long battle lies ahead. Lung Cancer In both Australia and New Zealand Lung Cancer rates are far higher than the global average. This is mainly down to the indegenous Aborignal and Maori groups, who still regularly use tobacco as part of everyday life. Estimates suggest as many as 40% of New Zealand's female Maori population use tobacco, whilst in Australia rates across both genders have dropped by 10% since 2004, but still remain well above the 40% mark. 85% of lung Cancer cases are caused by the use of (or excessive exposure to) tobacco. Its symptoms can leave people short of breath, coughing aggressively and even leads to the coughing up of blood. Cancer awareness in both locations is high however, and this figure should continue to drop over the next two decades. Heart Disease In the 1980s Australia had some of the highest rates of heart disease in the world. Thankfully it has dropped significantly since then, however it remains a big killer in the country. According to the latest figures, 600 out of every 100,000 deaths in the country came directly from heart disease, and with obesity rates rising globally this looks set to be an issue for years to come. New Zealand is facing a massive battle with obesity. Currently it’s estimated that 1 in every 3 adults in the country is obese, with this figure rising for Maoris and being even greater for Pacific Islanders. Childhood obesity rates are also on the rise, meaning that the number of deaths from heart disease looks as if it will continue to rise in the future. Job Opportunities Interested in working in Australia or New Zealand? Here are a few attractive roles we currently have on offer. Locum Senior Medical Officer - Australia Emergency Medicine Registrar - Australia General Practioner - Australia Child and Adolescent Psychiatrist - New Zealand Consultant Endocrinologist, Diabetologist and Internist - New Zealand Specialist Anaesthetist - New Zealand

W1siziisijiwmtgvmtavmjkvmtqvmdavndqvntewlze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Billions Committed to Saudi Healthcare

NMC Health and Saudi state-run investment group Hassana have concluded a SR6bn (£1.2bn) deal to develop a new network of facilities in the Kingdom. The agreement, signed late last week, will see NMC expand its scope of care and footprint throughout the Desert Kingdom - potentially creating as many as 10,000 new jobs. Abu Dhabi based NMC are one of the biggest healthcare groups in the Gulf, employing more than 1,200 doctors throughout the region - with this expansion into Saudi Arabia set to further consolidate their market position. The group’s expansion in Saudi is focused on developing specialist centres based on five areas: IVF, long-term health management, plastic surgery, paediatrics and endocrinology. All areas where demand is expected to continue to grow in the near future. Hassana meanwhile are the investment arm of Saudi’s social insurance group, and their CEO, Saad bin Abdul Mohsen Al Fadhli, outlined his aims. He said: “The partnership between Hassana and NMC Saudi Arabia has ambitious growth plans across different health care sub-sectors. Both sides are committed to providing the highest standards of health services and boosting revenues.” Whilst NMC CEO Prasanth Manghat explained their decision to invest in the Kingdom. He added: “The Saudi government’s forward-looking and investor-friendly policies make the kingdom one of the most attractive destinations in the region for investment in the healthcare sector.” We’ve got a range of jobs currently on offer in Saudi Arabia, and an unrivalled network of contacts in the Kingdom. For more information, and the latest job alerts, register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtavmjkvmtmvntmvmjevmtqwl1vbruzlyxr1cmuucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

At a Glance - United Arab Emirates

It can be difficult to know where to start when planning a move overseas, especially if you aren’t sure where your future could lie. That’s why our latest Odyssey Exclusive series ‘At a Glance’ will help provide you with a quick overview of each location we work with, to help you decide if a move to the country could be worth pursuing. Article eight - The United Arab Emirates Where is it? The UAE is located around 5,500 miles from London in the heart of the Gulf region. It borders Saudi Arabia, Oman and the Gulf itself. This central location makes it the ideal place from which to explore the rest of the Middle East, Asia and even North Africa. Getting to the country couldn’t be much easier. Emirates Airlines offer direct flights almost daily from Heathrow, Stansted, Gatwick, Birmingham, Manchester, Glasgow and Newcastle to Dubai - with a flight time of around seven hours. It’s easy to get around too, with a developed road network and cheap taxis and public transport readily available. How is Healthcare Structured? As with most locations there is a public and private healthcare system within the country. The private system provides the main job opportunities for Western trained doctors, surgeons and physicians - with new vacancies opening up every month. The best known hospital in the country is probably the American Hospital Dubai, a modern 187 bed facility, that has recently been extensively renovated to take its capacity up to 240 beds. In 2000 the American Hospital Dubai became the first in the Middle East to be awarded JCI accreditation, and since then it has maintained this seven times. Nowadays there are more than 100 other facilities in the country with JCI Gold approval, proving just how high the standard of care on offer is. The UAE’s most well known area for healthcare is the world renowned Dubai Healthcare City (DHC), a healthcare ‘free economic zone’ located near Dubai International Airport. The healthcare city is home to over 110 clinics and hospitals specialising in everything from dermatology, to neurology and dentistry. Construction on the second phase of the development is well underway, with an impressive growth in patient numbers and medical tourists driving the Emirates’ healthcare facilities forward. No matter what your specialty is it’s highly likely that Dubai Healthcare City will be home to an opportunity. Medical tourism is huge business throughout the Gulf, and the UAE is the region’s leader. The state of the art facilities, and fierce competition for business has lead to unrivaled levels of spending - and this works its way down to the medics, who can benefit from generous (tax free) salary packages. What will I need? We’ve got quite a few openings available in the UAE at the moment, all have their own criteria - however most employers will look for: A Medical degree from a WHO approved school Western board certification (UK, USA, France, Germany etc) At least 3 years experience post specialist registration Fluency in English What are the positives? Very modern facilities A large, diverse and friendly expat community A high quality standard of living Plenty to do, from the Burj Khalifa to Ferrari World Year round sunshine What are the negatives? Dubai especially can feel manufactured The heat can be oppressive Still not as liberal as countries in the West Current Roles We’ve got plenty on offer in the UAE on our website, here are three of the most popular roles. Locum Consultant Gastroenterologist Consultant Paediatric Intensivist Emergency Medicine Physicians

W1siziisijiwmtgvmtavmjkvmtmvntcvmzevndi0lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Maternal Health in Australia

Australia has released a new report studying maternal health in the country, with more women than ever now opting for Caesarean Sections. According to figures published in the National Core Maternity Indicators report, the percentage of women giving birth via a CS has risen from 25.3% to 28.5% since 2004, a figure that follows recent international trends. The number of small babies born after 40 weeks has dropped however, from 2.1% to 1.4%, whilst the number of women seeking antenatal care within the first 13 weeks of pregnancy has risen from 65.9% to 68.6%. Some of the most in-depth data was in relation to smoking rates during pregnancy, and especially inequalities relating to race and geography. Smoking whilst pregnant greatly increases the chance of stillbirth, with a third of all deaths in the womb relating to smoking. As well as this it puts the child at a greater risk of a range of other conditions, such as asthma, ADHD and ear infections. According to the figures, more than 45% of Aboriginal and Torres Strait Islanders smoked during pregnancy, compared to the national average of just 10.4%. Throughout the country the overall smoking rate actually dropped in every territory, however the figures remain incredibly varied. In New South Wales just 7.8% of women smoked during the first 20 weeks of pregnancy, a drop of 2.7% since 2011. In Northern Territory meanwhile the figures dropped by 4.9%, but remained more than double those in NSW at 20.9%. Australia has always been a popular location for expats from Europe seeking to make a better life for themselves overseas. To find out what the country could offer you, and to receive the latest job alerts, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmtavmjuvmdkvmtuvntqvodm3lze5qmfocmfpbk5ld3muanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Bahrain to Host Dermatology Exhibition

Bahrain will welcome some of the world’s leading experts in dermatology and plastic surgery next month, as the country hosts its first event focused on skincare and aesthetics. Scheduled for November 29 and 30 at Manama’s Crowne Plaza, the Bahrain Dermatology, Laser and Aesthetics conference and exhibition will combine a series of workshops and seminars, with the ultimate aim of engaging patients more effectively to improve health outcomes. Of the workshops on offer, five are focused directly on fitting into the Bahraini healthcare system - whilst others look at minimally invasive surgery, burns treatment and areas like Botox and fillers. Dr Nidal Abdulrahman Khalifa, the conference’s President, outlined the goals that she has set. She said: “We aim to promote these practices to enhance the Bahraini practice. We hope to advance the skills of Bahraini doctors, technicians and authorised practitioners. We also intend to spread awareness of non-qualified personnel that perform cosmetic medical procedures, and the harmful health complications and the issues that can arise. “The conference is also hosting roundtable discussions with key personnel to reach key recommendations to shape the future of the Dermatology, laser and aesthetics field in Bahrain.” Whilst Dr Ahmed Darwish Shada, Dr Rahman’s deputy, added: “This conference and exhibition is part of the national plan of Bahrain to be a world-class destination in the field of medical training and tourism. “This builds on the talented human capital, forward-thinking government and strategic location of Bahrain. The conference is an excellent chance to follow up on the latest scientific research, and the current international techniques in the field of Dermatology and plastic surgery.” Bahrain, with its relaxed island mentality and world leading salaries, is considered by many to be one of the Gulf’s hidden gems. Job opportunities are therefore infrequent, so register on our website today for job alerts - and get ahead of the rest.

W1siziisijiwmtgvmtavmjqvmtevmzevmtmvmtg4lze5r2xvymfstmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Life Expectancy in China Set to Soar

China's life expectancy could rise by almost six years over the next two decades, whilst Spain is set to overtake Japan as the the country with the longest living population. According to figures published in medical journal 'The Lancet', China's life expetancy is expected to rise from 76.3 years to 81.9 by 2040 - taking it from 68th globally to 39th. Whilst China was one of the fastest improving nations in the report, the United States looks set to plummet from 43rd to 64th. Increasingly stagnant lifestyles, combined with unhealthy diets and the high cost of healthcare will see average American live just 1.1 years longer by 2040. At the other end of the table meanwhile, Japan looks as if it will lose its crown to Spain, which is expected to increase its average lifespan by a remarkable three years by 2040 - lifting it from fourth to first, fractionally above the land of the rising sun. The Lancet's report also identifies the top five factors that it believes will lead to premature death in the future, with high blood pressure topping the list. It was followed by having a high BMI, blood sugar levels, using tobacco and excessive consumption of alcohol. China's increasing life expectancy is testament to the high levels of investment being poured into the country's healthcare sector. This means that it is the ideal time to make a move to the country for anyone seeking to influence the future of healthcare. For more information, and job alerts, register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtavmjqvmtivntkvmdmvmta0lze5s3v3ywl0rmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

At a Glance - Kuwait

It can be difficult to know where to start when planning a move overseas, especially if you aren’t fully sure where your future could lie. That’s why our latest Odyssey Exclusive series ‘At a Glance’ will help provide you with a quick overview of each location we work with, to help you decide if a move to the country could be worth pursuing. Article eight - Kuwait Where is it? Kuwait is located in the North-Western corner of the Gulf, bordering Iraq and Saudi Arabia. It is around 500 miles from Bahrain, and 1,100 north of Abu Dhabi. British Airways and Kuwait Airways both offer regular non-stop flights from London to Kuwait International Airport, which lies just over 10 miles from the capital, Kuwait City. The country’s Northern Gulf location makes it ideal for anyone looking to explore the region by air, with Bahrain, The UAE and even Oman reachable in under two hours. Getting around the country itself can be slightly trickier, with driving standards well below those in the west and pedestrian infrastructure limited. As a result we’d recommend using a taxi or employing a driver to help navigate the dangerous roads. How is Healthcare Structured? In Kuwait there is a private and public healthcare system. The public system is free at the point of need for Kuwaiti nationals (who make up just 30% of the population) and can be accessed by expats if they pay an annual fee. The public system can be extremely busy, and so trial schemes have been introduced banning expats from visiting hospitals, clinics and surgeries at certain times, whilst plans for separate expat hospitals have also been implemented. Most well off expats in Kuwait will use the private healthcare system, where waiting times are much lower and no curfews are in place. Private healthcare fees are controlled by the government and so, although they can be expensive, they are capped to keep them in the reach of most. Kuwait is the Gulf’s second richest country, and as a result it can afford to invest in healthcare. This investment pays off with the average life expectancy of those in the country rising by almost 15 years since 1970. Further to this the number of state and private hospital beds has also continued to grow as the population ages. Currently there are over 7,000 public hospital beds, and over 1,100 in the private sector according to the latest official figures (published in 2014). What will I need? All openings will have their own criteria - however most employers will look for: A medical degree from a WHO approved medical school Completion of a Western residency programme Ideally board certification from a Western country: USA, Canada, UK, Ireland, France, South Africa etc At least three years of experience post specialist training - the more the better Fluency in English A knowledge of Arabic would also be looked upon very favourably What are the positives? Plenty of Museums and cultural attractions Low crime rates Very high salaries A large, friendly expat community Plenty of recently opened, modern hospitals What are the negatives? Looks more dated than many other Gulf locations Poor pedestrian infrastructure The heat can be stifling in summer Parts of society remain segregated based on gender We currently have no open positions available in Kuwait, however that could change very soon. To receive job alerts when opportunities become available, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmtavmtcvmtivmzqvndmvntiyl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Dubai - Breast Cancer Awareness

Dubai’s Ministry of Health has launched a new month long campaign aimed at raising Breast Cancer awareness in the Emirate. The campaign will place a major focus on the importance of undergoing regular screening checks, with the recovery rate from the condition rising by almost 90% when it’s caught at an early stage. A mobile mammography clinic will tour the Emirate during the month, with results, information and support available on site. Further to this, the Ministry is hosting a range of activities and events focused on the issue, with hopes high that the increased awareness will help the UAE meet its 2021 and 2025 health goals. Speaking about the campaign, assistant undersecretary for health clinics and centres, Dr Hussein Abdel Rahman Rand, said: “The Breast Cancer Awareness and Prevention Program is part of the Itmenan campaign, which involves the Universal Periodic Examination and Early Detection of Cancer initiatives adopted by the Council of Ministers. The campaign seeks to reduce cancer morbidity and mortality rates in the country. “The ministry is promoting a healthy lifestyle in local communities, by collaborating with its partners in implementing the provisions of the National Strategy for the Control of Noncommunicable Diseases 2017-2021. “This partnership corresponds with the ministry’s core strategy to provide a comprehensive and integrated health care system delivered in innovative and sustainable ways.” Could you help the UAE in its battle with Cancer? We’ve always got a steady stream of job opportunities in the country, but they’re usually highly sought after. Register on our website today to get ahead of the rest. A dream role could be closer than you might imagine.

W1siziisijiwmtgvmtavmtcvmtivmjivmzqvmtqvmtlowkzlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

At a Glance - New Zealand

It can be difficult to know where to start when planning a move overseas, especially if you aren’t fully sure where your future could lie. That’s why our latest Odyssey Exclusive series ‘At a Glance’ will help provide you with a quick overview of each location we work with, to help you decide if a move to the country could be worth pursuing. Article Seven - New Zealand Where is it? New Zealand is located more than 11,000 miles from London, south-east of Australia. This makes reaching the country an arduous task. There are no direct flights available from the UK, but plenty with connections are easily bookable. A one-stop flight can take between 22 and 25 hours, whilst a two-stop can often take more than 26. The country can also be deceptively large, with internal flights between the northern tip of the North Island and South Island taking more than three hours. For someone keen to explore a continent, New Zealand isn’t ideal. How is Healthcare Structured? The healthcare system in New Zealand is a mixture of a public/private hybrid system and a smaller fully private system. The public system is either free or heavily subsidised for the country’s citizens at the point of need, and this is paid for partially by an innovative scheme called ‘The Accident Compensation Corporation’ (the ACC). The ACC covers the cost of treatment for cases which are deemed to be as a result of an accident, such as injuries sustained playing sport or in a road traffic collision. The funding is received from levies which are placed on employers, employees and even vehicle registrations. Non accidental injuries and illnesses for which the patient requires treatment is provided free of charge - assuming that the patient has been referred by a GP or family doctor. Whilst this secondary treatment is free the initial visit to the GP will cost between $45NZD and $60NZD (around £22 - £30). The public health system in New Zealand is split into 20 different district health boards (DHBs). 15 of these serve the 3.5 million North Island residents, and 5 operate for the 1 million on the South Island. The private system is smaller than many other countries, making up roughly 23% of the market, but it plays a crucial role in easing the workload on the state system. This keeps the average waiting times for common surgeries like knee and hip lower than they are in the UK, and ensures that a focus can be placed on the quality of the service not the time taken. In the country as a whole 11.1% of the total GDP is spent on healthcare, a larger percentage than other major countries like the UK, Japan, Spain and Finland. This investment is reflected in a higher than average life expectancy, a figure that is continuing to rise at an impressive pace. It is estimated that a newborn child in New Zealand will now live to the age of 93. A figure that is a tribute to the success of the system, and healthy lifestyle that it promotes. What will I need? We’ve got quite a few openings available in New Zealand at the moment, all have their own criteria - however most employers will look for: Eligibility for registration with the Medical Council of New Zealand. FRACP or equivalent from a Western location Fluency in English Some experience post certification What are the positives? A relaxed way of life Little culture shock for Westerners Stunning scenery Employers are focused on maintaining a healthy work/life balance An extremely low crime rate What are the negatives? It can feel very isolated Poor public transport infrastructure makes owning a car a necessity The cost of living can be high, with everything from food to accommodation coming at a premium Current Roles We’ve got plenty on offer in New Zealand on our website, here are three of the most popular. Child and Adolescent Psychiatrist Consultant Geriatrician Specialist Anaesthetist

W1siziisijiwmtgvmtavmtcvmtivmzivmdavnjyxlze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Australia - Mental Health & Wealth

A new study has shown a direct link between mental health and wealth in Australia. The research, published this month in the Health Sociology Review journal, showed that a person’s income and wealth directed impacted a range of mental health factors - but had no bearing on physical health. Dr Garth Kendall, lead author of the report, explained the findings. He said: “We wanted to determine whether the socio-economic gap seen in many health outcomes in high-income countries, such as Australia, is best explained by differences in individuals' perceived economic security as determined by their levels of income and wealth. “We found that income and wealth both influenced mental health, but a person's perception of their economic security is better explained by income than wealth. This is because income can be used to purchase goods and services to fund consumption on a day-to-day basis, which is more likely to affect one's perception of economic security.” The report now recommends the introduction of policies that will help open up more opportunities to people to earn a greater income, whilst reducing the socio-economic gap that clearly exists in the country. Australia has always been a popular destination with expats, especially those seeking a change from the NHS. For more information, and the latest job alerts, register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtavmtavmtivmtgvmtgvota4lze5q2hpbmfgzwf0dxjllmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

At a Glance - China

It can be difficult to know where to start when planning a move overseas, especially if you aren’t fully sure where your future could lie. That’s why our latest Odyssey Exclusive series ‘At a Glance’ will help provide you with a quick overview of each location we work with, to help you decide if a move to the country could be worth pursuing. Article Six - China Where is it? China is such a vast country that the distance from London varies greatly. The capital, Beijing, is just over 5,000 miles away however, and there are plenty of regular flights available from Heathrow - with a travel time of just under ten hours. Despite tts size, getting about China isn’t too difficult. The major cities all have outstanding public transport systems, whilst exploring further afield locations can easily be done via plenty of regular (well priced) flights. How is Healthcare Structured? China’s healthcare system has developed and changed drastically over the past two decades, with increasing immigration and the country’s rapidly growing wealth helping to shape a futureproof model. Healthcare is mainly hospital focused in China, with patients usually going directly to specialists for support. As with most other locations, the market is split into public and private facilities, however the public sector is not as attractive to expats. Almost all expats (and a sizeable chunk of the new Chinese middle class) will have private health insurance, and this provides them with access to an ever-growing market of high quality facilities. China is keen to reach the highest standard possible in healthcare, and there is a growing Western presence in the market. Many of these new ventures are actively seeking experienced Western medics to help build departments. This, combined with attractive salaries and an opportunity to experience a new culture, makes a move very attractive to medical professionals keen to leave a legacy. What will I need? We have plenty of opportunities on offer in China at the moment, for Consultants and medics looking to lead departments. All the roles have unique criteria, but most will look for: A Medical degree from a WHO approved school Western residency (UK, USA, Canada, Australia, New Zealand, South Africa etc) Ideally at least five years experience Board certification or specialist registration Under the age of 60 The enthusiasm to make a lasting impact What are the positives? An opportunity to shape healthcare for the future Great for career progression A fascinating local culture Safe surroundings Good job security Incredible modern facilities What are the negatives? Tax rates make a move less financially rewarding than the Gulf Heavily developed busy cities aren’t for everyone Air pollution in Beijing is a serious issue The cost of living can be high in the major expat hubs Current Roles We’ve got plenty on offer in China on our website, here are three of the most popular. Chief of Dentistry Emergency Medicine Consultant Director of Thoracic Surgery

W1siziisijiwmtgvmtavmtavmtivmzevndevmjg4lze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

13% of Diabetics in Saudi Undiagnosed

Saudi Arabia has been named as the world’s largest market for diabetes, with a quarter of the population now battling the condition according to a new WHO survey. The World Health Organisation report shows that Diabetes is now becoming a modern day epidemic in the Desert Kingdom, with unhealthy diets and a lack of exercise leading to rates soaring. Even more concerningly it’s estimated 13% of people with type-2 Diabetes remain undiagnosed, putting them at a far greater risk of developing heart disease, kidney issues and a problems with their vision. New techniques that go beyond simply lowering glucose levels are now being looked at, with a focus also placed on lowering blood pressure and stabilising weight loss. Speaking about the opening of a three day educational program focused on the issue, Chairman of the Saudi Scientific Diabetes Society, Professor Abdulrahman Al Sheikh, said: “Early combination therapy with Dapagliflozin and Metformin is an appropriate treatment option that enables those with T2 Diabetes to achieve individualized glycaemic goals, either as initial combination therapy in treatment-naive patients or as Dapagliflozin add-on in patients inadequately controlled with Metformin therapy.” Are you an Endorcrinologist who could help Saudi Arabia in its battle with Diabetes? Register on our website today for job alerts. A life changing move could be far closer than you might imagine.

W1siziisijiwmtgvmtavmtavmtivmjqvntuvnda5lze5tlpozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

New Zealand: Rural Mental Health Rates Soaring

Young Maoris living in rural New Zealand are at a significantly higher risk of developing mental health issues than any other group in the country. According to new figures published during Mental Health Awareness Week, 70% of Kiwis have felt their stress levels increasing over the past five years - with this figure rising to a remarkable 85% for those between the ages of 18 and 39. Perhaps even more worryingly however 56% of those surveyed do not feel prepared to talk about their mental health concerns, with half of that group putting this down to the stigma that still exists.. This stigma also explained why rates for Maoris, where traditional attitudes remain widely held, were so high. 13/41 (31%) of suicides in New Zealand’s rural Northland were Maoris, despite this group making up just 14% of the total population. A combination of traditional attitudes and a lack of access to mental health support in more rural locations is proving deadly, with young Kiwi men - especially Maoris - having one of the highest suicide rates in the Western world. That has prompted medical innovator and mental health campaigner, Dr Lance O’Sullivan, to speak out. He said: “It’s no secret New Zealand is in the midst of a mental health epidemic, and this is a reminder that the effects of this are widespread. “The shortage of mental health professionals across the board, means that there is no quick fix, however, mental health resources are increasingly being accessed remotely via online platforms or mobile applications. “If people are experiencing negative emotions or feeling isolated, they should always reach out to a trusted party, whether that be someone they know or a health professional. People should know that they’re not alone.” Could you help New Zealand in its battle with mental illness? Register on our website today for the latest job alerts - a life changing move could be far closer than you might imagine.

W1siziisijiwmtgvmtavmdmvmtivmzuvmjkvmjizlze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Saudi Requires 178,000 More Beds by 2050

Saudi Arabia could require more than 178,000 new hospital beds by 2050 to cope with a growing and ageing population. According to a comprehensive new report published by Colliers International, longer life expectancies, rocketing rates of obesity and diabetes and an estimated 19 million births over the next 32 years present the Kingdom’s sector with a real challenge for the future. Estimates suggest that Saudi healthcare leaders will now need to raise between $23.6bn and $37.3bn to bring the country in line with the global average of 2.7 beds per 1,000 people. To help prepare for the changes, the report’s authors recommend targeting the region’s changing demographics. Over the next 20 years the ‘babyboomers’ will be replaced by generation X, Y. Z as the largest group. Disease patterns will change with the demographics, with this group more likely to suffer from chronic conditions and cardiovascular issues. This has prompted the report too call for the more introduction of more long-term care facilities, and centres of excellence focused on areas like Ophthalmology, Cosmetic Surgery and Sports Injury management. Mansoor Ahmed, Director of Healthcare, Education and Public/Private Partnership at Colliers International, said: ““Healthcare providers and professionals are grappling with several challenges concurrently, such as patients becoming customers and the patientcare transitioning from ‘fee for quality’ rather than ‘fee for service’. “Coupled with new compliance requirements that aim at growing wellness and prevention whilst ensuring better coordination and efficiency, we hope we can add depth and complexity to an increasingly competitive marketplace.” Healthcare in Saudi Arabia looks set to continue to grow to cope with demands outlined in the report, and that’s great news for anyone thinking of a move to the country. For more information, and job alerts register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtavmdmvmtivmzevmzgvotczl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Hypertension Awareness in the UAE

Almost half of residents in the United Arab Emirates aren’t aware of the dangers caused by high blood pressure. In a survey co-published by Dubai Health Authority, 45% of more than 1,000 respondents did not classify high blood pressure as a serious health issue, whilst 44% were unaware that it could be fatal. Perhaps even more concerningly 47% of people surveyed weren’t aware of the symptoms of high blood pressure, with this especially high among Emiratis (61%) and those between the ages of 18 and 24 (58%). Estimates currently suggest that over 30% of those living in the Emirates currently have high blood pressure, and this figure is continuing to rise sharply. To help raise awareness of the issue, Dubai Health Authority has launched a new three year ‘Heart Your Heart’ initiative, aimed at increasing understanding around cardiovascular health. As well as a range of outreach methods, the initiative will also connect with medics and insurance providers to implement wide-ranging tests for hypertension - to catch the condition at a stage where it is easier to manage. Despite a slowdown in the global oil price, the UAE remains committed to ensuring that it is home to world leading standards in healthcare. For more information, and the latest job alerts, register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtavmdmvmtivmjyvmdmvmzmvmtltaw5nyxbvcmvgzwf0dxjllmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

test video

test video text

W1siziisijiwmtgvmdkvmjcvmtmvndkvmzavodc0lze5qmfocmfpbkzlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

At a Glance - Bahrain

It can be difficult to know where to start when planning a move overseas, especially if you aren’t fully sure where your future could lie. That’s why our latest Odyssey Exclusive series ‘At a Glance’ will help provide you with a quick overview of each location we work with, to help you decide if a move to the country could be worth pursuing. Article Four - Bahrain Where is it? Bahrain is an island in the Gulf, linked to Saudi Arabia by the staggering 16 mile long King Fahd Causeway. It is often referred to as the Gulf’s jewel in the crown, with its small size ensuring that it gets a cooling coastal breeze. It’s also one of the most liberal nations in the Gulf, making a move a gentle introduction to life in the region. Regular, cheap flights can have you in Dubai or Abu Dhabi within an hour and a half, whilst London is just over six hours away - with plenty of regular flights available with both British Airways and Gulf Air. How is Healthcare Structured? Recent statistics show that the healthcare system - which is one of the best funded in the Gulf region - is enjoying a great deal of success. Life as a medic within the Bahraini healthcare system is far removed from the lifestyle endured by many working in the NHS. Akin to the National Health Service the state system is free at the point of need for Bahraini nationals (and heavily subsidised for expats), unlike in Britain however these people only make up around 46% of the total population. When combined with the small population this means that the healthcare system in the country is rarely stretched beyond its means. Funding for the system is also generous, far more so than in most European countries. This ensures that hospitals are not understaffed, doctors and specialists aren’t overworked and a healthy work/life balance is achieved. One of the main reasons that many people give for wanting to escape from the NHS is the ever growing paperwork and bureaucracy that prevents them from doing what they love - working with patients. In Bahrain this isn’t an issue, with hospitals having administrative departments who deal with the limited paperwork. This can allow medics to focus on clinical care, working with the state of the art equipment within the hospitals to treat patients. What will I need? The criteria will change on a job-by-job basis, but most employers will look for the following: A medical degree from a WHO approved medical school Completion of a Western residency programme Board certification from a Western country: USA, Canada, UK, Ireland, France, South Africa etc At least one year of experience post specialist training Fluency in English What are the positives? Generous tax-free salaries A traditional island lifestyle A central location Lower cost of living than the UAE A friendly local population What are the negatives? Still not as liberal as the West The summer heat can be oppressive The modern skyscrapers can create an artificial feel

W1siziisijiwmtgvmdkvmjcvmtmvndkvntavodkwlze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Australia Unlikely to Hit WHO Target

Calls for a ‘Sugar Tax’ and other tougher legislation have grown in Australia, as the country attempts to fight the growing burden of chronic disease. New figures have shown that the country is now unlikely to hit World Health Organisation targets for Chronic Disease by its 2030 goal, with women set to be more than a decade late in reducing the number of deaths from chronic disease by a third. With one in ten countries reporting a rise in the number of deaths from cancer, cardiovascular disease and diabetes, calls from strong legislation (such as a ‘Sugar Tax’) are now back on the agenda. Implemented in more than 20 countries including the UK, Mexico and South Africa, the sugar tax results in a drop of almost 10% of annual consumption of sugary beverages. Speaking to the Royal Australia College of GPs, Public Policy Director at Australia’s Cancer Council, Paul Grogan, said: “Sugary drinks are one of the starkest examples of a widely known product of no nutritional basis marketed to people at risk of other chronic diseases. “Australia is a world leader in tobacco control as a result of government action, but you can perform very well in one area and poorly in another. “Nutrient-poor food is widely promoted like never before - and that’s a matter governments can act on.” Australia remains a hugely popular location with medics seeking a more rewarding career overseas. This is especially true for General Practitioners who feel overworked and undervalued in the NHS. For more information on how to secure a move, register on our website today. A dream role could be closer than you might imagine.

W1siziisijiwmtgvmdkvmjcvmtmvndkvmdavmtq3lze5r2xvymfstmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Where is the World's Most Efficient Healthcare System?

Singapore has once again been named as one of the world’s most efficient healthcare systems, with Australia and the United Arab Emirates also securing places in the top five. Bloomberg’s Annual Healthcare Efficiency Report for 2018 studied more than 200 countries with populations above five million, and scored each based on the value for money of the healthcare outcomes achieved. Hong Kong topped the report, with a high life expectancy of 84.3 being recorded - despite just 5.7% of GDP Per Capita income being spent on medical care. Singapore followed, with Spain, Italy and South Korea rounding out the top five - albeit more than 16% behind the leading duo. Elsewhere Australia jumped two places to eighth position, despite showing the highest average cost in the top ten. The UAE meanwhile dropped a position to tenth, but notably remained above Norway, Switzerland and France. Despite worryingly high youth suicide rates, New Zealand remained 15th, albeit with a life expectancy that was over a year lower than near-neighbour Australia. Canada also remained in a stable position - 16th - some 39 places above the United States. China dropped by one to 20th, with the country’s slowly increasing life expectancy still below many other Asian locations. Despite the UAE’s strong performance it wasn’t all good news for the Gulf, with Saudi Arabia falling behind Germany into 46th position. Chile (-23), the Dominican Republic (-15) and the United Kingdom (-14) showed the biggest drops, whilst Thailand (+14) and Norway (+9) demonstrated the greatest improvements in efficiency. For more information on how to secure a move to any of the countries mentioned register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmdkvmtkvmtivmjgvmdevntizl0nhbmfkyu5ld3muanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

At a Glance - Canada

It can be difficult to know where to start when planning a move overseas, especially if you aren’t fully sure where your future could lie. That’s why our latest Odyssey Exclusive series ‘At a Glance’ will help provide you with a quick overview of each location we work with, to help you decide if a move to the country could be worth pursuing. Article Three - Canada Where is it? Canada is located just over 3,800 miles from London - across the Atlantic Ocean, bordering the USA to the South and Alaska and Greenland to the North. The country is vast, and at more than 9.98 million km² it’s second only to Russia in terms of size. Despite this, the population is small and focused mainly around the major cities - with smaller rural towns scattered throughout the various provinces. Travel time is something you’ll need to adapt to, with the Canadian perspective of distance somewhat different to that in Britain. Expect a ‘short drive’ to last up to three hours! How is Healthcare Structured? The Canadian Healthcare system is similar to Britain’s National Health Service. A portion of the budget is provided by the national government, with a further payment being made by an employer or employee - in a similar way to the UK’s National Insurance system. Unlike in the UK however further funding is provided by the federal government. This combined approach ensures that the contributions from citizens can be lower than it is in the United Kingdom, despite the total funding actually being greater. Whilst this is a noticeable difference between healthcare in Canada and the UK, it’s not the only one. In Canada all healthcare providers are private, this means that (unlike the UK) pay for medics is not determined countrywide. Doctors also claim directly to the insurer when people use the country's healthcare system (known as Medicare) to cover the costs. This results in a healthcare system which is far more successful than many others, especially the United States’ which demands a far greater amount of funding. What will I need? The criteria will change on a job-by-job basis, but most employers will look for the following: A medical degree from a WHO approved medical school Completion of a Western residency programme Board certification from a Western country: USA, Canada, UK, Ireland, France, South Africa etc Eligibility for registration with the Canadian college in your area Fluency in English (and, in some areas, French) What are the positives? A welcoming and friendly local population High quality medical facilities A safe environment, and very low crime rate Little culture shock for Westerners Stunning scenery What are the negatives? The distances make travelling time-consuming The cost of living can be high Extreme weather conditions - especially in Winter Wages aren’t tax-free, and so a move to the Gulf is more financially rewarding Current Opportunities We’ve got a couple of openings in Canada at the moment Consultant Internist Anaesthetist

W1siziisijiwmtgvmdkvmtkvmtivmzyvntevmjcwl2f1c3ryywxpyw5ld3mylmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Australian GP's Reveal Most Common Issue

Patients in Australia are talking to their GPs about mental health more than any other issue, according to this year’s RACGP Health of the Nation Report. Published this week, the report showed another small rise in the percentage of patients seeking psychological support from their GP (from 61% to 62%), with respiratory conditions remaining the second biggest area of conversation - despite dropping by 10% over the past year. Elsewhere a rise was reported in the number of people seeking support for endocrine conditions, whilst the pregnancy rate remains level at 14%. Some of the most fascinating information related to emerging health issues, where GPs were asked what their biggest health concerns for the future were. Out of 85 different responses, mental health was the most common, followed by obesity, diabetes, ageing care and drug addiction. The report also examined the gender balance, both in terms of the GP sectors makeup, and the different health conditions most frequently brought to professionals of different genders. Female GPs - who make up 45% of the system - were far more likely to work with patients who had mental health issues than males, whilst for the third consecutive year the number of GPs trained overseas remained above those trained in Australia and New Zealand. Across all indicators GPs are largely satisfied with all areas of their employment, with the freedom they are given to choose their own working methods scoring especially highly. Overall more than 90% of those responding to the report said that they were ‘satisfied’ or ‘very satisfied’ in their job. GPs are always in high demand in Australia, meaning that job opportunities for Western trained medics are readily available. For more information, and to secure your dream role ‘down under’ today, register on our website. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmdkvmtkvmtivmzqvmdivnte2l3npbmdhcg9yzw5uzxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Singapore - Project Silver Screen

Singapore’s Ministry of Health has launched a new screening programme focusing on those over the age of 60. Known as ‘Project Silver Screen’, the new campaign will provide free or subsidised screening for hearing, eyesight and oral issues to the country’s growing elderly population. The cost will range from S$2 to S$5 per person, with the pioneer generation - those born before 1950 - being given complimentary access to thank them for their contribution to society. By making screening more readily available to the elderly, the Singaporean Government hope that they can identify potential issues at an early stage - to ensure that the best possible outcomes can be met. Likewise, research compiled by John Hopkins University has shown the links between issues with hearing and other problems like falls - potentially increasing the strain on the country’s healthcare sector. In the small amount of screening carried out so far, almost 50% of people had issues with their vision, a third had dental problems and 70% had at least mild hearing loss. Following diagnosis a voucher scheme will allow patients between S$15 (£8) and S$200 (£110) off a range of equipment - such as glasses, dentures and hearing aids. Speaking at the launch event for the new campaign, Health Minister Gan Kim Yong, said: “Through the functional screenings we hope to be able to detect their conditions early to prevent early deterioration. This way, we will be able to help our seniors stay healthy and stay well longer. “Beyond chronic conditions, we are also concerned about how to help them maintain their functional abilities so that they can remain active.” Job opportunities in Singapore are scarce and highly sought after. To put yourself in the best possible position to secure one, register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmdkvmtuvmdgvmtmvmjyvndywl05aiexhdgvzdc5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Suicide Rates in New Zealand Continue to Rise

Health authorities in New Zealand are being urged to do more to combat skyrocketing suicide rates. The calls came during World Suicide Prevention Day last week, where it was revealed that the number of Kiwis taking their own lives had risen by 10% - to 660 - by June this year. Those represent the highest figures since records started being kept in 2007, with the country’s Health Minster, David Clark, describing the new statistics as; “upsetting, sobering and cause for further reflection.” Despite the figures already being worryingly high, experts have warned that they may actually be even greater - with a great number of cases remaining unreported. Despite plenty of effort to normalise mental illness, a stigma still remains - especially amongst young people, the elderly and the Maori community - where people may lack the confidence to seek professional help. President of the Association of Mental Health Councillors, Bev Webers, highlighted what she believes would help reduce the stigma. She said: "You go and have a check-up on your car, you get your warrant of fitness. You have a check-up on your body, make sure it's alright, we would like to see that it becomes part of what we do for our mental wellness.

W1siziisijiwmtgvmdkvmjyvmtevmdkvmzkvmtmvu2f1zglgzwf0dxjllmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Saudi Healthcare Sector Largest in the Region

Saudi Arabia’s healthcare sector is now the largest in the Middle East according to a senior minister in the Kingdom. Speaking at the official opening of Riyadh’s World Health Forum, Health Minister, Tawfiq Al-Rabiah, announced that the sector is now worth in excess of SR150bn - around $40bn - thanks to a healthy mix of internal and external funding. Al-Rabiah was quick to point out that the sector couldn’t afford to standstill however, with the Desert Kingdom reaching a crucial stage in its history. An ageing population, a rise in chronic conditions, and the increasing cost of healthcare globally have all combined to ensure that future generations have a challenge on their hands to continue the positive trend. Further to this, the Kingdom finds itself in a situation where it drastically needs more trained medical professionals to help deal with the changing demands of the population. It hopes that increasingly liberal laws can help attract more highly trained staff, whilst various incentives and education plans have been introduced aimed at extolling the virtues of leading a healthy lifestyle. A comprehensive restructuring programme of both public and private healthcare facilities is also set to be introduced, aimed at restoring governance in the sector. Al-Rabiah commented: “This will enable the ministry to focus on its fundamental role in formulating policies and legislations as well as to enact laws and regulations to guarantee the quality and standard of the health services.” If you would like to help Saudi Arabia as it continues to grow and develop register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmdkvmjcvmtivmjcvmzuvnjc5l1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Tuberculosis Awareness in the UAE

The United Arab Emirates is launching a new nationwide campaign to help educate people about the dangers of tuberculosis. Two years ago the Emirates loosened residency restrictions for people entering the country with the condition, and those with previous scars. The previous restrictions had seen a rapid drop from 4.2 cases per 100,000 inhabitants in 2000 to just 0.79 per 100,000. Now a campaign is being introduced with the aim of eradicating the condition totally. Based mainly in the Northern Emirates of Dubai and Sharjah it aims to highlight that TB remains an issue, educating people on the symptoms to watch out for - and pointing out the importance of quick detection. Director of Preventative Medicine at the Ministry of Health and Prevention, Dr Nada Al Marzouqi, said: ““The strategies focus on familiarising individuals with the preventive and therapeutic procedures taken by the ministry in cooperation with health institutions and health service providers in the state. “Our main aim is to educate the public about the need to commit to and complete the treatment with appropriate preventive measures to avoid the transmission of infection." For more information on moving to the United Arab Emirates, register on our website today. A dream role could be closer than you might imagine.

W1siziisijiwmtgvmdkvmdqvmtivmzevmjkvnzevdwflbmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

King's College Grow in Dubai

King’s College Hospital have officially opened their new facility in Dubai’s stunning marina - the first in the area which will work to NHS standards. The London based group already run a flagship facility in Abu Dhabi, as well as a smaller clinic in Dubai, however the new medical centre represents a big step forward for their presence in the Emirates. Speaking at the opening ceremony, Director General of Dubai Health Authority, Humaid Al-Qatami, said: “The DHA is keen to support private sector investment, and such reputed centres with decades of experience and expertise help provide the population in Dubai with high-quality health care services. “Investment in the private health sector has witnessed sustained growth, and the DHA recently launched a health investment strategy, with the aim of promoting Dubai as a viable and competitive hub for need-based investment in healthcare.” Whilst newly appointed CEO of the hospital, Christian Schuhmacher, added: “Our utilisation results over the past year of other KCH facilities in the UAE not only demonstrate KCH’s unwavering commitment to healthcare in the UAE, but also show the real progress we are making in delivering evidence-based healthcare.” Schumacher was also keen to highlight one of the main aims of the new facility - to provide the most financially efficient standard of care. He continued: “Through only treating and prescribing what is scientifically necessary, we are ensuring that we are continually offering the most cost effective treatment options for our patients.” Is a move to the United Arab Emirates something which would appeal to you? Register on our website for job alerts - and start your odyssey today.

W1siziisijiwmtgvmdkvmdqvmtivmjmvmzgvmzq1l0f0qudsyw5jzuttqs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

At a Glance - Saudi Arabia

It can be difficult to know where to start when planning a move overseas, especially if you aren’t fully sure where your future could lie. That’s why our latest Odyssey Exclusive series ‘At a Glance’ will help give you a quick overview of each location we work with, to help you decide if a move to the country could be worth pursuing. Article Two - Saudi Arabia Where is it? Saudi Arabia is located 3,800 miles from London in the heart of the Middle East. It’s a vast country with more than 800 miles separating the Western city of Mecca from the Eastern Province and areas like Dammam. The size also means that Saudi has land borders with a whole host of countries: Jordan, Iraq, Kuwait, Qatar, The UAE, Oman and Yemen. There are regular flights from the UK, with a travel time of between six and eight hours depending on your end location. How is Healthcare Structured? It comes as a surprise to many that the healthcare system in Saudi is similar to Britain's NHS, albeit without National Insurance contributions. It is also supported by an ever expanding private sector, which caters for mainly the expat population as well as wealthy Saudi natives. The majority of hospitals are operated by the Ministry of Health. It runs 270 throughout the country as well as over 1000 health centres and clinics. Care is provided free of charge at the point of need for citizens, and this covers everything from GP appointments to specialist, complex surgery. There are obviously a few notable differences, mainly who the MOH care for. The Ministry of Health has 3 sub departments who care for separate groups of the population, running separate hospitals, clinics and health centres. These are MODA, MOI and SANG hospitals. MODA hospitals care for those in the Ministry of Defence and Aviation, MOI for those employed in the interior ministry and SANG facilities are for those in the Saudi National Guard. The 3 main offshoots from the MOH are joined by a few autonomous government agencies who deliver healthcare to various groups in Saudi society - including students and people with severe learning disabilities. Ministry of Health facilities are well funded, with the pressure that the system could potentially find itself under from the expat community lifted by an increasingly large private sector. Currently the private system runs 127 hospitals, and hundreds more clinics and centres. Job opportunities within the private sector are becoming more widespread but remain hugely sought after due to higher pay, despite usually offering fewer incentives than government facilities. What will I need? The criteria will change on a job-by-job basis, but most employers will look for the following: A medical degree from a WHO approved medical school Certification from a Western country: USA, Canada, UK, Ireland, France, Germany, Sweden or equivalent A minimum of three years experience as a Consultant Fluency in English A clean medical license No malpractice claims What are the positives? High salaries, no income tax and a low cost of living makes a move very rewarding financially A unique cultural experience An easy going, slow pace of life A sizeable and friendly expat community Plenty of additional incentives within salary packages Increasingly liberal laws and rules What are the negatives? The heat can be stifling, especially in the summer Plenty of historical rules remain in place Segregation between men and women is still widespread There is little entertainment - with no cinemas or theatres outwith compounds Smaller hospitals and clinics often aren’t to the required standards Current Opportunities We’ve got a vast range of openings in Saudi Arabia - here are a few that might be of interest. Consultant Spinal Surgeon - Al Khobar Consultant Ophthalmologist - Jeddah Consultant General Surgeon - Jeddah

W1siziisijiwmtgvmdkvmdqvmtivmjcvmtqvnzmvyxvzdhjhbglhbmv3cziuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Almost 70% of Aussie Women Suffering Anxiety

Almost 70% of women in Australia have reported feeling nervous or anxious within the past month, whilst 46% have already been diagnosed with a mental illness such as depression or anxiety. Those were some of the standout findings in a survey of more than 15,000 women that was published last week, with the ‘Sandwich Generation’ identified as the group at most risk of developing mental health issues. The ‘Sandwich Generation’ are women who currently find themselves juggling two very different issues: On one hand they may have a young family, whilst on the other they’re having to deal with elderly parents - and the accompanying health conditions that come with age. Despite the concerning headline statistics, Australian women are now smoking less and exercising more than ever before. Despite this however more than half (50.8%) still described themselves as overweight or obese. The rise in prevalence of mental health conditions even came as a surprise to researchers, with busier than ever lifestyles blamed for the sharp growth. According to the report 34% of respondents didn’t get any time to themselves in a normal week, and Janet Michelmore, Director of the Jean Hailes for Women's Health Foundation, who carried out the survey, was quick to point out where she believes the issues could stem from. She said: “Women are trying to do too much or they think they're expected to do so much. “I think social media plays a part in this, whatever you see on social media is the perfect look. I've never seen anyone looking bedraggled or grumpy. “I think women are great supporters and great nudgers of other people, and what we hope this survey will do is give women a gentle but firm nudge to take greater care of themselves. “Take time to put yourself first, make sure you know about your health, know what the risks are and appreciate that small changes have big rewards.” Could you help Australia in the country’s battle with mental illness? Register on our website today - and start your odyssey to a more rewarding career.

W1siziisijiwmtgvmdgvmjgvmtmvmjevndgvmjg4l0f0qudsyw5jzufvcy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

At a Glance...Australia

It can be difficult to know where to start when planning a move overseas, especially if you aren’t fully sure where your future could lie. That’s why our latest Odyssey Exclusive series ‘At a Glance’ will help give you a quick overview of each location we work with, to help you decide if a move to the country could be worth pursuing. Article One - Australia Where is it? Australia is located more than 9,000 miles from the United Kingdom in Oceania. The country itself dominates the continent, with only New Zealand vaguely comparable in terms of size and lifestyle. Travel time from London to Sydney is around 22 hours - with a stop over, whilst even visiting relatively close neighbours like Malaysia can take over eight hours on a flight. How is Healthcare Structured? The healthcare system in Australia is split into public and private facilities - just like it is in the United Kingdom. The public system is funded by a combination of the government - who dedicate 9.4% of the country's total GDP to it (a figure fractionally greater than the that of the UK) - and the people of the country, who contribute through a 2% levy known as ‘Medisave’ on their income. This combination ensures that the publicly funded healthcare system in Australia is financially secure. Incentives are also in place to encourage the use of the private system and ensure that the state system does not find itself overrun and underfunded. Perhaps the most notable of these incentives is the Private Health Insurance Rebate (PHIR). Under this scheme ‘Medicare’ makes a contribution towards your healthcare costs based on your earnings and age. The percentage increases as you get older, and decreases as you earn more ensuring that it helps out those who are most in need. PHIR allows the healthcare system to focus more on the quality of care it provides instead of the quantity of patients who pass through the doors. It ensures that, unlike the NHS, the state system is not overworked, creating a far less stressful working environment for medics. What will I need? The criteria will change on a job-by-job basis, but most employers will look for the following: A medical degree from a WHO approved medical school Completion of Residency in a Western country (UK, USA, Canada, New Zealand, South Africa) CCT or equivalent A clean medical license Fluency in English A clean criminal record What are the positives? Australia’s healthy work/life balance is envied worldwide A well organised, financed and structured healthcare system Little culture shock for Westerners, especially from the UK/US and Canada It can be more financially rewarding, with better basic salaries Good job security The country is naturally stunning An active lifestyle is promoted and easy to maintain thanks to great weather and plenty of sports facilities What are the negatives? Australia can feel extremely remote, with few countries nearby Even travelling internally can be extremely time consuming Salaries aren’t as high as in the Gulf Food and utility bills are higher than in Europe Current Opportunities We’ve got a few openings in Australia, here are some of the best. General Practioner Consultant Child and Adolescent Psychiatrist Director of Emegency Medicine

W1siziisijiwmtgvmdgvmjgvmtmvmtyvmdcvmjy1l3npbmdhcg9yzw5uzxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Ageing Health in Singapore

Singaporeans over the age of 60 should live longer healthier lives thanks to a range of new initiatives. Announced last week by the country’s Prime Minister, Lee Hsien Loong, to mark Singapore’s national day, elderly people can expect to enjoy more subsidised healthcare, greater access to polyclinics and exclusive packages only available to those over the age of 60. Known as ‘Mordeka’, the new package is only available to those born between 1950 and 1959, and will provide top-ups to existing health insurance funds, as well as payments that will help to meet the cost of long-term care. Polyclinics are also set to grow to help meet the changing demands of an ageing population, with six new facilities set to open across the city by the start of 2023. Speaking as he announced the news, Prime Minister Loong said: “We want all Singaporeans to have access to affordable, high-quality healthcare. “By opening new polyclinics we will make sure there is affordable, accessible, high-quality primary care throughout Singapore. “I think we especially owe something to the independence generation.” Job opportunities in Singapore are rare and highly sought after. To put yourself in the best position to secure one, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmdgvmjgvmtmvmdkvntmvmtkzl3vhzw5ld3muanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Rare Surgery in Ras-Al-Khamaih

Medics at RAK Hospital in the UAE successfully restored the vision of a patient suffering from Optic Neuritis following complex, rare surgery. Neuromyelitis optica as the condition is officially known is an uncommon issue, affecting a patient's spinal chords and optic nerves. The symptoms can vary on a case-by-case basis, but commonly include eye pain, shooting pains in the legs and in severe cases intermittent loss of vision. In this example the patient, a diabetic, also suffered from Positive Anti MOG syndrome, leaving his eyes resistant to antibiotics, and creating further complications. This made the pain even more severe, whilst the patient also found himself regularly losing the vision in both eyes. As a result surgery was the only option. Dr Sweta Adatia, Consultant Neurologist who carried out the surgery, explained the challenges she faced. She said: “Being diabetic and having the presence of anti MOG positive antibodies created several issues in the patient, including his inconsistent response to steroids and constant fluctuation in sugar levels. “Tapering high dosage of steroids, essential for the treatment, immediately led to repeated attacks, while other immune therapies didn’t help either. “There have only been a few hundred such cases recorded so far where the patient with Optic Neuritis was found positive for the MOG antibody, causing the condition to relapse despite treatment with steroids and other immunosuppressive agents. “This obviously meant we hardly had any evidential data to support us during the treatment plan. However, despite encountering several obstacles, we were eventually successful in stabilising the attacks with the help of pulsed steroid therapy while maintaining the regular oral steroids.” The United Arab Emirates remains one of the most popular locations with expats seeking a more rewarding career overseas. For more information on how to secure your move, and job alerts, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmdgvmjevmtivmtevmdyvndg3l0nhbmfkyuzlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

5 Things to Prepare for in Canada

Canada has always attracted a steady stream of expats, especially those from the UK and elsewhere in Western Europe. A friendly culture, a range of job opportunities and stunning scenery make it a favourite, but there are plenty of things to prepare for before committing to a move. Five Things to Prepare for in Canada 1 - Distance Canada is enormous, and the sheer size of the country comes as a shock to many people. Placed on a map Canada would stretch from the United Kingdom to Turkmenistan, and between Spain and the Gulf of Finland. This makes travelling between provinces time consuming, and the Canadians have a totally different sense of distance to anyone else - meaning a ‘short drive’ could be up to five hours! It also means that the country has numerous different identities, with each province having a unique character and culture. Make sure that you research the area you’re moving to thoroughly, and don’t just assume that all of Canada is very similar. 2 - Weather Canada’s weather can be extreme - though this isn’t the case everywhere in the country. In certain areas of Newfoundland temperatures can change from summer averages of 20°C, to winter temperatures of -9°C. It’s far from the most extreme area though. January average highs in Manitoba are -21.9°C, whilst summer averages are almost 20°C in the positive. Basically what we’re saying is pack a wide range of clothes. From heavy winter jackets to light shorts and t-shirts. 3 - Lengthy Recruitment Process Canada is very strict about who it allows in, with all documents needing to be thoroughly checked and verified prior to a working visa being granted. The system in the country is well organised, and things do move efficiently, but having your documentation prepared and organised prior to applying is a must. In some cases hospitals may be able to expedite the visa process, so it’s always worth enquiring with them about how urgently they require you to start. 4 - Taxes What you see is what you get...Except in Canada what you see on the price ticket won’t be what you pay. The Canadian tax system differs depending on what province your in. Sales taxes are just 5% in Alberta, but almost 15% in Quebec. So be prepared for a quirk of Canadian taxes, the price shown on shop labels is always excluding VAT - to allow for the same base product prices nationwide, with the tax differences adding on at the till. This can be annoying at first, however in no time at all you’ll find yourself being able to work out percentages as you shop! 5 - Language French and English are both official languages of Canada, and most Canadians will have a fluent grasp of one, and a working knowledge of the other. English is the most widely spoken language, however in Quebec almost 80% of people used French as a first language. On top of this various dialects are spoken throughout the provinces that can sometimes make English feel like a foreign language! Is a move to Canada something which would interest you? We’ve got a small number of jobs available in the country, meaning that a dream move could be far closer than you might imagine. Register on our website to start your Odyssey today.

W1siziisijiwmtgvmdgvmjevmtivmdmvmdivody2l05aiexhdgvzdc5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

School Dental System Requires an Overhaul in New Zealand

New Zealand’s school dental system requires a radical overhaul, with more than 100 children having teeth removed every day. According to the New Zealand Dental Association more than 96,000 schoolchildren are overdue check-ups, leading to almost 30,000 extractions in school age children last year alone. Speaking at the association’s conference last weekend, president, Dr Bill O’Connor, highlighted just how concerned he is about the issue. He told delegates: “Today, 120 young Kiwi kids will have teeth extracted. Why have they not been treated before they got to this point? “The system has failed these children and their parents, and the system has failed those who work in it, trying to deliver the best outcomes for their patients. “Children don't get to choose what they eat or drink, they don't choose to have rotten teeth and the pain and suffering that comes with that. "They don't choose to live in areas that are woefully unable to meet the treatment needs of the population “It's time to look after our kids.” In response National Clinical Director for Oral Health, Riana Clarke, said: “15% of children were overdue for appointments with the Community Oral Health Service, which falls below our targets. “We are continuing to work with District Health Boards to reduce the number of overdue appointments.” Based on this we can expect to see a rise in the number of dentistry positions available in New Zealand, so register on our website today to get ahead of the rest. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmdgvmjevmtivmdcvntmvndizl3vhzw5ld3muanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Fewer Patients Leaving UAE for Medical Care

Fewer patients are leaving the UAE for medical care, whilst the number of health tourists visiting the country continues to rise. Those were the major findings from Dubai Health Authority’s 2017 annual statistical report, which illustrated a positive future for healthcare in the Emirates - with the drop in the global oil price not having as big an impact on the sector as initially feared. Treating Emirati patients with complex needs at home has been a long-term aim of the country, and with just over 1,500 people now heading abroad annually, health leaders look to have been successful in addressing the skills shortage forcing locals to look elsewhere. The average cost per patient receiving care overseas has also dropped substantially, from Dh3.12m (£660,000) to Dh2.7m (£570,000). Almost a quarter of those leaving the Emirates for medical care were looking for greater Oncology services, with Neurology the second most popular speciality. That wasn’t the only good news for the area in the report however, with medical tourists now contributing Dh1bn (£212m) to the economy. The UAE is now also on target to treat 500,000 medical tourists by 2020, with people now heading to the Emirates from all over the world. Estimates suggest that reaching that target could be worth more than Dh2.6bn annually to the country - a figure that is expected to grow by 13% each year. The United Arab Emirates - especially Dubai and Abu Dhabi - remains one of the most popular locations we work with. If you believe a move to the country could enhance your career, register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmdgvmtqvmtavmzavntmvntu2l3vhzw5ld3muanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

UAE & Saudi Top Wellbeing Report

People in Saudi Arabia and the UAE are enjoying a higher level of wellbeing than those in the UK, France and even Singapore. In a report published by health insurance giants Cigna, Saudi Arabia and the Emirates scored above the global average, with the report looking at various areas from physical wellbeing to workplace happiness and job satisfaction. More than 14,000 people from 23 countries took part in the survey, which showed a very slight drop in the quality of life in the UAE - mainly owing to higher working hours and a drop in physical health. Some of the most interesting findings related to healthcare however, with 76% of respondents saying that they are in favour of sharing data about their health - if it helps lowers costs, enables early detection and provides better access to suitable care. A high demand for private healthcare was also noted in the UAE, however with only 20% of respondents expecting to have health insurance once they retire the funding of this, especially in Emirates where insurance isn’t compulsory, is an area that will need addressed. There are plenty of attractions to both Saudi Arabia and the United Arab Emirates. From the opportunity to help shape the future of healthcare to high tax-free salaries, there should be something for everyone. For more information, register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmdgvmtqvmtmvmjgvmzgvmte4l0noaw5hiezlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

5 Things to Know About Guangzhou

We’re noticing a steady stream of expats showing interest in moving to China, and with the country developing at an incredible rate that’s hardly a surprise. Many people know about the major hubs of Beijing and (especially) Shanghai, however few people know much about the southern city of Guangzhou which is rapidly developing, and becoming a real favourite with expats. Here are five things to know about China’s ‘Flower City’. 1 - An Ideal Location Guangzhou is located in Southern China, more than 1,400 miles from Shanghai and 2,000 from Beijing. It’s far from isolated though, with ever-popular Hong Kong reachable in under two hours via regular trains, and Macau just a 90 mile drive away. High-speed trains also link the city with Zhuhai, known as the Chinese riviera. 2 - Traditional Charm & Expat Hubs Whether you’re planning on living in a modern skyscraper in the heart of the city or a quieter expat dominated community, Guangzhou can offer both. Tianhe is the most popular expat suburb, located just 20 minutes to the east of the city centre. Liwan and Haizhu are also popular thanks to a large expat community, and a good variety of local restaurants and amenities. For someone seeking a quieter life the neighbourhoods of Panyu and Baiyun offer a good standard of living without as much hustle and bustle as the city. 3 - Shopper’s Paradise Guangzhou is renowned throughout Asia as somewhat of a shopper's paradise. The city is a major hub for the creation of goods, and as a result prices are low and the variety is unlikely to be beaten. Expect a considerably lower cost of living than in Beijing, Shanghai and Macau. It’s also home to some of China’s best shopping malls and supermarkets, making it easy to find Western goods, fresh food and plenty of bargains. 4 - Laid Back Lifestyle China’s major cities are famed for their busy, high intensity lifestyle. In Guangzhou though everything feels a little more laid back. The pace of life is a little slower, and everyone seems more content to actually enjoy life. Walks, parks, restaurants and cultural activities are all more popular than elsewhere, and despite being large the city has more of a homely feel to it when compared to the major hubs. 5 - International Schooling China is famed for how high quality its education system is. Every year attainment levels seem to rise, with education considered by many families to be the single most important factor in a child’s development. As a result it should come as little surprise that China is home to some outstanding international schools. The best are highly sought after however, so make sure to apply and secure your child’s place prior to boarding the plane - to avoid any hold ups or disappointment. Could Guangzhou be the city for you? Register on our website for job alerts today.

W1siziisijiwmtgvmdgvmtqvmtevmjkvmdmvntivu2f1zglozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

NEW REPORT: Saudi Healthcare Among Most Efficient

Saudi Arabia’s healthcare sector has been named as one of the most efficient globally in a new report. Published this month, the Saudi system came in just six points behind world leader Singapore in Royal Philips’ Future Health Index (FHI). The Kingdom was especially praised for the high level of trust placed in the healthcare sector by the general public. Singapore’s score puts it more than 17 points ahead of the global average, with only a below average number of beds for the size of population marking it down. Of the five outcomes, Saudi’s sector impressed with the high quality outcomes achieved for patients, the lower than average costs and waste, high levels of patient satisfaction and a high quality patient experience. The report also highlighted a major area which will need to develop to keep up with the demands of the modern patient - healthcare technology. Data collection will play a key role in this, with the Desert Kingdom falling below average on indicators around the use of data analytics to boost healthcare effectiveness. Despite this however CEO of Philips’ in the MET region, Ozlem Fidanci, said: “The index results confirm the Kingdom’s e-health strategy is a pivotal pillar in the future for improving and managing people’s health. “The FDI offers a meaningful measure that helps countries like Saudi Arabia identify their immediate needs and readiness for artificial intelligence tools to become a part of the patient journey.” Is a move to Saudi Arabia something which would interest you? We’ve got a large range of exciting opportunities on offer on our website. So have a browse and apply today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmdgvmdcvmtivmzavmjuvmjmxl1nhdwrprmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Five Attractions of Saudi Arabia

Making a move is about much more than simply boosting your earnings or challenging yourself professionally. It also gives you the opportunity to explore a new part of the world. That’s a major attraction for many of the expats we work with, so in our new series we’re going to look at five major attractions to some of our most popular locations. Part 4 - Five Attractions of Saudi Arabia Read any guide to Saudi Arabia and it’ll immediately mention finances. A move can be extremely rewarding financially, however we’re keen to be a bit different and look at the other reasons for the Desert Kingdom’s popularity. 1 - Changing Attitudes People used to be put off a move to Saudi Arabia by the traditional rules and attitudes that defined the country - and restricted those in it. Things are now changing however, and with the Royal Family keen to encourage more people to the Kingdom, big changes have already been noticed worldwide. Saudi was famous for not allowing women to drive, but that changed in June of this year. Likewise rules around dress codes and music have been relaxed as the country attempts to build a more tourist friendly image. That’s great news for expats, who can secure a move to the Kingdom now, with interest expected to rise exponentially over the next decade. 2 - A Unique Experience Often when people refer to the culture of Saudi Arabia they are speaking about the religion, and it’s true that Islam does dominate everyday life. There are other unique experiences in the country though. Whether it’s enjoying traditional food in the desert, or simply seeing animals transported around in the back of a pick-up truck, Saudi is a location that will leave you with a different story to tell for every day spent there. 3 - Family Life Whilst talk of finances dominates any discussion about a move to Saudi, the positive impact that it can have on your family life is also something that is regularly mentioned. The Saudi lifestyle is built around spending time with your family, so expect shorter than average working hours and plenty of national holidays. There are also plenty of family friendly restaurants and facilities, making the Kingdom ideal for those looking for more family time. 4 - Ideal Location Saudi Arabia isn’t just in the heart of the Gulf region, it’s practically in the middle of the world, making it ideal for travelling around the planet. From Jeddah you can reach Dubai in two hours, India or Paris in five and Australia in 12. You’ll rarely meet someone living in Saudi who isn’t well travelled, with regular well-priced flights available to help you take advantage of the extra time away from the workplace. 5 - Tourism It might seem hard to believe based on stereotypes from the Kingdom, but Saudi Arabia is building a growing list of tourist attractions. Whether it’s one of the country’s World Heritage Sites like Turaif fort, the National Museum in Riyadh or even the new Al Shallal Theme Park, you might be surprised by just how much it has to offer. To start your Odyssey to Saudi Arabia, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmdgvmdcvmtivmjyvmtuvnja5l05aiexhdgvzdc5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

GP Clinic Psychologists in New Zealand

Psychologists could soon be based in GP clinics in New Zealand, as the country attempts to help ease its mental health crisis. Based at the Kouri Integrated Family Health Centre in Palmerston North, hopes are high that early intervention could be the key in preventing more serious mental health cases from developing. The new pilot scheme is being developed with two major aims; to help people experiencing mild to moderate mental health conditions that could be at risk of escalating, and to help de-stigmatise mental illness. Often people battling mental health conditions experience fear or anxiety when faced with the prospect of asking for specialist help and support, and so by basing a psychologist in the familiar surroundings of a GP’s clinic part of this hurdle should be removed. Speaking about the plan, Clinical Director for Kauri Healthcare, Dr Anna Skinner, said: “It has been amazing to have expert and effective psychological interventions available on the same day to patients with mental health needs, as well as to those with long-term conditions who really benefit from support to acknowledge, accept and manage their complex health conditions.” Is a move to New Zealand something that would interest you? We have plenty of vacancies on offer in the country, with Psychiatrists especially in demand. For more information, and job alerts, register with us today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmdgvmdcvmtivmjivntqvodcyl0noaw5hie5ld3muanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Cancer Care Affordability in China

Cancer medication should be more affordable in China from next month thanks to a new agreement. Negotiations between the country’s state medical insurance provider and pharmaceutical companies have almost concluded, with news agencies reporting that treatments for Non-Small Cell Lung Cancer, Renal Cell Carcinoma and Melanoma are all set to benefit. Since early last year the price of clinically proven but costly medication, such as Bortezomib and Heceptin has dropped, whilst in May taxes of between four and six per-cent were also removed to help ease the financial burden on Cancer patients. For pharmaceutical providers China is one of the world’s biggest markets for Cancer drugs, with $14.9bn spent in 2016 alone - a total that accounts for 18% of global sales. The high cost however has left many Chinese people struggling to survive, with the costs of Cancer treatment often in excess of $24,000 - more than 1.5 times the average salary in the country. China is facing a growing issue with Cancer prevalence, with Breast Cancer rates growing at an average of 3.5% annually, and Lung Cancer figures already amongst the highest on the planet. This makes finding a solution that won’t break the bank all the more critical in ensuring a positive future for patients. If a move to China’s fascinating capital of Beijing, or expat hub of Shanghai is something that would appeal to you, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmdgvmdevmdkvndcvmzcvodiyl3vhzw5ld3muanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

New Report Praises Healthcare in the UAE

The United Arab Emirates offers patients the best healthcare in the Middle East according to a new report. Mandatory health insurance and the use of the latest Artificial Intelligence technology were given as the major reasons for this success, according to BMI Research’s Middle East Healthcare Access Index. Saudi Arabia, Kuwait and Oman followed the Emirates - perhaps somewhat surprisingly for outsiders given how often these locations are overlooked by medics seeking a move to the region. Key to the UAE’s success however was the way in which it has embraced modern technology to deal with the changing demands of a growing and ageing population. 3D printing and Virtual Reality rehabilitation were noted as being especially progressive in the Emirates, whilst the benefits of an estimated 6.6% annual growth rate in healthcare funding was also highlighted. Speaking about the findings, the report’s authors said: “Innovation in clinical services and the use of new technologies in disease diagnosis and treatment will drive a more patient-centric healthcare system. “Benefits of developments in 3D printing include faster turnaround times, more personalised design and functionality, and greater flexibility in terms of replacements.” If a move to the UAE, Saudi Arabia, Oman, Kuwait or elsewhere in the Gulf would appeal to you register on our website today. A dream career move could be closer than you might imagine.

W1siziisijiwmtgvmdcvmzevmtevmzuvmzuvos9dagluysbgzwf0dxjllmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

5 Things You Have to Experience in Shanghai

Making a move is about much more than simply boosting your earnings or challenging yourself professionally. It also gives you the opportunity to explore a new part of the world. That’s a major attraction for many of the expats we work with, so in our new series we’re going to look at five things not to miss out on in some of our most popular locations. Part 3 - Five Things You Have to Experience in Shanghai 1 - Go on a Food Tour China is renowned worldwide for its cuisine, and Shanghai is the perfect place to experience authentic Chinese food. The best way to do this is by going on a food tour, these run from the mid-afternoon and allow a local guide to take you round some of the best restaurants in the vast city. From high-class dining to rustic hidden gems. If you’re living in Shanghai it’s an absolute must. 2 - Maglev Train We normally wouldn’t bother recommending public transport, but Shanghai’s incredible Maglev train is quite different. Capable of travelling at speeds in excess of 265mph, the Maglev is an incredible feat of engineering that perfectly sums up just how technologically advanced the city itself is. There’s even a museum looking at the history and future for the levitating railway. 3 - The Old City Whilst Shanghai is known as a modern metropolis with stunning skyscrapers (and fast trains!), there is still plenty of traditional Chinese charm. A small portion of the wall that protected Shanghai from Japanese invaders can still be seen, whilst the winding alleyways and bustling streets feel a world away from the large modern highways. 4 - Jing’an Temple Sticking with the traditional attractions, the city’s Jing’an Temple appears surreal surrounded by modern shopping centres and skyscrapers. Originally constructed in 247AD, it has been moved, rebuilt and even used as a factory during its life - but now stands as a proud monument to China’s past, surrounded by its future. Arguably the most beautiful building in the city it holds a mesmerising charm that shouldn’t be missed. 5 - Shanghai Financial Centre Observation Deck Back to modern Shanghai now, and something that definitely isn’t for someone bothered by heights! Shanghai’s Financial Centre’s observation deck provides unbeatable views from the building’s 100th floor - more than 1,500 feet above the ground! If you want to understand the sheer scale of the city, then nowhere can offer a better perspective.

W1siziisijiwmtgvmdcvmzevmtevmjyvntivmtyzl1nhdwrptmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

NEW REPORT: Saudi Population in Good Health

Almost 95% of the Saudi population are generally in good health, according to a new report published this week. The findings, which covered all 13 provinces in the Kingdom between November and December of last year, found that 94.2% of the population are in good health - with a quarter of people over the age of 15 going for regular medical check-ups. Despite this however the rate of chronic conditions remains high - especially in females over the age of 65. Diabetes was an exception, with the condition affecting roughly one in ten Saudis - mainly men. Rates of Heart Disease were also high, with an estimated 1.14% of the population battling conditions that are closely linked with unhealthy lifestyle choices. On publication of the survey a spokesman for GaStat who compiled it said: “The survey was carried out conforming to international standards adopted by the World Health Organization and the United Nations. The indicators of the study included marriage, fertility, child and maternal health, infant mortality, car accidents and smoking. “The statistics will be the main source of demographic information for preparing development plans in the health and social care sectors at a national level.” Is a move to Saudi Arabia something you’re considering? The Desert Kingdom is one of the most popular locations we work with, register on our website today to avoid missing out on the job of your dreams.

W1siziisijiwmtgvmdcvmjuvmtevmdmvmzivmjm0l0doyw5hiezlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Have You Considered a Move to Ghana?

Ghana in West Africa is a location that few think about when considering a move overseas. However the country is developing at an impressive rate, and has become one of Africa’s most popular expat hubs. Why is it so popular with expats though? We’ve taken a look at five reasons to consider a move to the country. 1 - Financially Rewarding Finances are probably the single biggest factor attracting people to a new life overseas, and Ghana can offer surprisingly attractive salary packages considering the image of poverty often associated with Africa. Healthy basic salaries can be boosted by high commission rates, with employers also meeting the cost of transport and accommodation to ensure that they attract the highest possible standard of talent. Coupled with a low cost of living, you might be surprised about just how rewarding a move can be. 2 - Kind & Welcoming Population Ghanaians are considered some of the most friendly people on the planet, and their positive, friendly attitude is noticeable throughout the country. It won’t take long to settle into the way of life, and the local population will be only too happy to help show you around. Learning a bit of the local language will also be hugely appreciated - even if you’re far from fluent! 3 - Opportunity to Make a Lasting Impact Healthcare in Ghana is really starting to develop as the country becomes more and more financially prosperous. This gives you the opportunity to be involved in the start of something that could be really special. Bringing Western qualifications and experience to the country will be invaluable, and you could have a major say in the way healthcare in the country is organised for ever. For a medic keen to leave a legacy, a move to Ghana could be ideal. 4 - ‘Easy Africa’ A move to Africa can be extremely daunting, however expats have christened Ghana ‘Easy Africa’ because of how little culture shock they experienced after making a move. Accra is home to many large organisations’ African HQs, meaning that there is a large expat population and plenty of high quality hotels, restaurants and modern developments in the city. Ghana’s also peaceful, with little conflict between different religious groups in the country and neighbouring locations. 5 - Safety As well as being peaceful, Ghana is also one of the safest places in Africa. There is little serious crime and, assuming your savvy on the streets and know the areas to avoid, petty crime levels are also low. This makes it one of the few African countries where it’s safe for an expat and their family to walk the streets - even after dark. To find out more about upcoming roles in Ghana, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmdcvmjqvmtivmdevmjqvnzyyl0nhbmfkyu5ld3muanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

What's Your Stroke Risk?

Researchers in Ottawa, Canada, have published a new online calculator that can tell people how likely they are to have a stroke within the next four years. Based on data from ‘Statistics Canada’s’ health surveys, the new application calculates a person's risk based on those who have suffered a stroke or other serious cardiovascular condition whilst leading a similar lifestyle. The program asks users to input details about their tobacco and alcohol consumption, fruit and veg intake, underlying health conditions and their height and weight. Powered by the latest ‘Big Data’ technology, the research can also predict how long the user can expect to live, showing the data on a sliding scale based on their estimated heart age. Lead author of the research, Dr Doug Manuel, explained why he believes the new development is truly unique. He said: “We hope this tool can help people and their care team with better information about healthy living and options for reducing their risk of heart attack and stroke. “Doctors will check your blood pressure and cholesterol levels, but they don’t necessarily ask about lifestyle factors that could put you at risk of developing heart conditions. “What sets this cardiovascular risk calculator apart is that it looks at healthy living whilst being better calibrated to the Canadian population.” Would you be interested in finding out how at risk you are? You can have a look at your score by using the calculator here. Lifestyle related health conditions are a major issue worldwide, and Canada is no exception. Is this a good idea to help target the issues, or is it just a gimmick that will have no impact on people’s lives? Let us know on our social media channels.

W1siziisijiwmtgvmdcvmjqvmtevntgvndmvnjcyl05aiexhdgvzdc5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

New Pilot Psychiatry Scheme in New Zealand

New Zealand has announced a new $10 million pilot scheme that will offer free mental health counselling to young people in the country. Youth mental health is a huge issue in New Zealand, with the country’s teenage suicide rate the highest in the developed world. This has been blamed on a ‘toxic mix’ of family violence, bullying and teenage pregnancies. Introduced by the Green Party, the new initiative will mainly target those who have left the security of school and now aren’t sure where to turn for health and support. According to recent statistics 75% of lifelong cases of mental illness started before people turned 25, with a third of Kiwis who seek support being forced to wait for more than three weeks for help. A timescale that may prove too long for some. Clinical psychologist Cath Hunter, told the press about her hopes for the new program. She said: “The age group is more likely to be studying, struggling into work, on low wages or still dependent on family. “In my experience a lot of young people don't want to access a GP or other health professional and there is still a strong stigma attached to telling someone you are not coping. “The most obvious benefit of improved access would be reducing harm, potentially lowering our tragic suicide rate, and halting the development of more persistent mental health conditions, all of which take a much larger toll on family and other health services. “It would also help younger people achieve healthier relationships, less alcohol and drug abuse along.” Could you help New Zealand in its battle with mental illness? We’ve got a range of Psychiatry roles available on our website, meaning a dream move could be closer than you might imagine. Register with us today to start your Odyssey.

Experts in Professional Recruitment

Locum Internist / General Medicine Physician Consultant - New Zealand

Internist Consultant in Obstetric Medicine - New Zealand

Internist Consultant - General Medicine Consultant - New Zealand

Emergency Medicine Specialist - Saudi Arabia

Chief of Dentistry - Beijing China

Anaesthesia Nurse for Operating Theatre - Malta

OPERATING THEATRE MANAGER - MALTA - EUROPE

Senior Radiographer - Mammography

Hospital Director - Tianjin China

Calls for Australia to Legalise Nicotine E-Cigs

Global Health Issues 2019: Canada

'Tsunami' of Cancer Cases Expected in Gulf

The Odyssey Guide to Riyadh

Dammam Hospital to Open Soon

Dental Services Needed in Malta

Chinese Research Links Stress & Cancer

Gulf Health Continuing to Drop

The Odyssey Guide to St John's

The Odyssey Guide to Abu Dhabi

UAE Legalises Vaping

Cervical Cancer to be Wiped Out in Australia

Oman Healthcare Roundup

Childhood Obesity Targeted in NZ

The Odyssey Guide to Muscat

Boost for UAE Donors

The Odyssey Guide to Malta

Saudi Tackling Tobacco

Thinking of a Move to Saudi Arabia?

Early Risers at a Lower Risk of Mental Illness

The Odyssey Guide to Auckland

Australia Targets Sugary Drinks

The Odyssey Guide to Jeddah

Elementary Health Checks in Saudi

Northern Territory Suicide Hotspot

New License in Dubai

The Odyssey Guide to Shanghai

Malta - Europe's Healthcare Hub

Boost for Mental Health in Australia

The Odyssey Guide to - Sharjah

Singapore to Ban Sugary Drinks?

Saudi King Passes Health Reforms

The Odyssey Guide to...Perth

Cost of Healthcare Rising in UAE

Make the Move 2019 - China

Smoking Rates Shock in Canada

'Diabesity Epidemic' in the Gulf

Make the Move 2019 - UAE

OECD: Australians in Good Health

Make the Move 2019 - Australia & New Zealand

Liver Cancer Rates Soar in Vietnam

FAO: Locums in Saudi Arabia

Make the Move 2019 - Saudi Arabia

Flu Rates Soar in UAE

test video

Mental Health Young Australians' Biggest Issue

HSBC Expat Explorer 2018 - Part 2 - The Gulf

Oman News Roundup

Diabetes Rates in the Gulf Could Double

HSBC Expat Explorer 2018 - Part 1

$778 Million Generated at Arab Health 2018

'Virtual Campus' Plans in New Zealand

Singapore Unites Against Diabetes

Greater Psychiatric Care in Dubai

Your Odyssey - Australasia

Billions Committed to Saudi Healthcare

At a Glance - United Arab Emirates

Maternal Health in Australia

Bahrain to Host Dermatology Exhibition

Life Expectancy in China Set to Soar

At a Glance - Kuwait

Dubai - Breast Cancer Awareness

At a Glance - New Zealand

Australia - Mental Health & Wealth

At a Glance - China

13% of Diabetics in Saudi Undiagnosed

New Zealand: Rural Mental Health Rates Soaring

Saudi Requires 178,000 More Beds by 2050

Hypertension Awareness in the UAE

test video