Candidates

W1siziisijiwmtkvmdcvmtcvmtmvmjyvmzyvnti1lze5t2r5c3nleuv4y2x1c2l2zuzlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

5 Reasons to Move to Oman

Making a decision on where your future lies can be a daunting prospect, with research often the key to deciding which location is right for you. To try and make things easier we’ve compiled these little guides - each looking at reasons why your future could lie in a select number of locations we work with. Article 8 - Five Reasons Why Your Future Lies in Oman 1 - Plenty of Incentives A move to Oman can come with plenty of incentives, as the country attempts to try and attract the highest possible standard of international talent. Salary packages are generous and accommodation or an accommodation allowance will usually be provided. Muscat’s relatively small size also makes it possible to get plenty for your money - with large out of town developments offering an excellent quality of life. 2 - Stable and Growing Whilst other locations in the Middle East have started to see their economy slowing, Oman’s has remained stable and secure. Unlike areas in the UAE, Qatar and other neighbouring Gulf States, Oman has not been hyper-developed at an unsustainable rate - meaning that the Sultanate’s economy is stable, and job security is much higher than elsewhere throughout the region. 3 - Large Expat Population, and Friendly Locals Due to a large expat population in Oman it is easy to make friends. There are a number of social clubs and organisations that expats can join and meet new people, especially in Muscat. There are things to do for everyone to do in Oman. There are clubs, bars and malls for the younger generation, for people who prefer the outdoors there are plenty of things to do from hiking in the mountains to camping in the desert. The Omani people are very kind and welcoming, whilst making an effort to learn Arabic is well received by the locals. 4 - Stunning Scenery Oman is one of the most naturally beautiful countries in the Gulf; home to rugged mountains, stunning coastlines and a rich culture. From walks along quiet unspoilt beaches,to mountainous safaris in the Western Hajar mountains near Muscat, there really is something in Oman for everyone who values a stunning natural environment. 5 - Cost of Living The cost of living in Oman depends on your location. The cost of living in a city like Muscat is a lot higher than neighbouring regions. However, salaries are adjusted to this. Eating Asian and Omani foods can be extremely cheap compared to eating Western food which can be very expensive. Fuel and cars are cheap in Oman compared to the West. Buying a car could turn out cheaper in the long-run as buses and taxis are the only mode of public transport - so having a car would be helpful for visiting rural areas.

W1siziisijiwmtkvmdcvmtcvmtevmzgvmtqvndmylze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Influenza Down Despite Deaths

Influenza appears to be on the decline in Western Australia experts say, despite four deaths in the past week. What is Influenza? Influenza is a highly contagious respiratory illness caused by a virus. The infection attacks your nose, throat and lungs and can be life-threatening for some population groups. Last year there had been over 2,000 cases and five deaths linked with the virus in the region. The WA Health Department revealed that the State’s Influenza related deaths have hit 52 this year. The number of Influenza cases has reached 19,327, which is a 926 percent increase from last year. However, the Health Department has warned not to compare the number of cases from last year as the season began two months earlier than the year before. “As previously said, the influenza season in WA has hit early,” a spokesperson said. “The peak influenza season in WA is generally between July and September each year. “The department cannot predict if these numbers will remain high for the duration of the usual season, or if we have seen an early peak.” Getting the vaccination would not prevent someone from coming down with the flu. However, people are still encouraged to get the vaccine as it is the best protection against the virus. Could your skills help Australia as the country battles with Influenza? Register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdcvmtcvmtevmzkvndcvmtg5lze5q2hpbmfozxdzicgxks5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

China Plans to Raise Healthy Years

China’s Government has revealed that it hopes to raise healthy life expectancy by a ‘moderately great extent’ by 2030. Healthy life expectancy is not to be confused with life expectancy, instead providing an insight into to provide a more representative insight into the overall health of the population - with the impact of long-term health conditions better represented. China’s healthy life expectancy at birth is already impressive, with newborns in the country now likely to enjoy 68.7 years of healthy life - a figure greater than those in the USA. Despite this however the country remains keen to improve over the next decade, with a range of plans in place to further improve the health of the nation. This includes an increased push for early cancer screening and diagnosis, with more standardised treatments set to be available at grassroots facilities, increased research and faster approval times for vital medications - with aims to push the five-year cancer survival rate from 40.5% to 46.6% by 2030. Further to this the country is targeting non-communicable diseases - by focusing on the lifestyle related decisions; such as a poor diet, smoking and a lack of exercise that can put individuals at a higher risk. As part of this the country looks set to follow the lead taken by other nations, through the introduction of unbranded cigarette packaging - with the idea already said to have been successful in the UK. Pollution is also being targeted, with China’s high rates of respiratory issues closely linked to the unhealthy air that blankets some of the major cities, leading to proposals being introduced for a new system to monitor and control the air quality. China is a fast developing country with an exciting future - and you can help to shape it. Register on our website today to start your Odyssey. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdcvmtevmdkvmdmvndavotiylze5q2fuywrhrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Five Reasons to Move to Canada

Making a decision on where your future lies can be a daunting prospect, with research often the key to deciding which location is right for you. To try and make things easier we’ve compiled these little guides - each looking at reasons why your future could lie in a select number of locations we work with. Article 7 - Five Reasons Why Your Future Lies in Canada 1 - Stable and secure long-term option If you’re looking for a stable location for a long-term move then Canada could be the ideal place to call home. Unlike many Gulf States, the country’s economy isn’t on the decline because of a drop in the oil price, whilst it isn’t developing at a potentially unsustainable rate either unlike some Far Eastern locations. It’s stable and secure. Canada is home to a G7 economy, regarded as the strongest and most stable in the world, and it is continuing to grow. As a country for a permanent relocation it looks an option that is difficult to top. 2 - Excellent education system Many of the candidates we speak to about securing longer-term moves often highlight concerns over the education of their families, however this shouldn’t be a worry in Canada. As well as a strong schooling system, the country is also home to some of the world’s leading higher education facilities. 3 - Visa options Securing a visa to start a new life overseas can be a hugely complex and stressful process, however in Canada it’s unlikely to be much of an issue - especially for well qualified and experienced medical professionals. Canada has high immigration targets and a range of sponsorship programs that can allow you to comfortably secure a long-term move to the country. 4 - Strong healthcare system Canada spends around 10% of its total GDP on healthcare each year, and as a result the system is as strong as you would expect. 70% of healthcare in the country is funded by the Government, with free basic care available to all citizens and residents in the country - making it both high quality and fair. 5 - Citizenship options If you are serious about a long-term move to Canada, and really see the future of you and your family being in the country then a range of citizenship options are available. The Canadian Government are keen to attract people seeking a long term move, with applicants only having to live in the country for three years over a five year period to apply - and practice tests available in advance of the real thing. If you’re looking for a long-term move to a location where you would be truly valued and welcomed then Canada would be ideal. Register on our website to take the first steps on your Odyssey today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdcvmtavmtevntmvmjgvmjevsxjlbgfuzexhdgvzde5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Ireland's Healthcare Quality Rated

Patients suffering cardiac issues in the Republic of Ireland could find their outcomes affected by their location according to a new report. The National Healthcare Quality Report showed clear inequalities in patients’ survival chances throughout the country, however it has been warned that these may not directly reflect the quality of care on offer. A range of other factors, namely an area’s demographics, travelling time and general health could also contribute to what initially appears to be a postcode lottery. Overall however the Irish system is said to be performing well, with a range of positives highlighted by the Department of Health. 84% of patients felt as if they were treated with dignity and respect, whilst 86% received surgery for hip fractures within two days of being admitted. Furthermore, the country’s hospitalisation rates for heart failure are below the international average, and over half of eligible individuals have now been screened for bowel cancer. It wasn’t all positive though, with diabetes rates nationally following global trends by rising, and only 35% of patients saying that they received adequate emotional support whilst in hospital. The report was released at the same time as Paul Reid was appointed as the country’s new Director General of the Health Service Executive, and he has already outlined plans to further develop community based healthcare services to ease the strain on acute facilities. We’ve recently started working with clients in the Republic of Ireland, and there have already been plenty of expressions of interest. Could a move to the Emerald Isle be the right one for you? Register on our website today, and start your Odyssey.

W1siziisijiwmtkvmdcvmtavmtevndgvntkvmtm3l1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Heat Advice Issued in UAE

Medics in the UAE have reminded residents of the dangers related to the intense heat, with temperatures set to soar this month. The mercury is expected to reach 45°C throughout July, whilst humidity could drop to a stifling 30% - meaning that most people will spend their days indoors throughout the month. Despite most residents being aware of the dangers, advice has still been issued to try and ensure that those in the country are able to avoid potentially serious issues. Hyperthermia, where the body’s temperature rises out with its normal range and above 40°C can lead to a range of symptoms, with some of them potentially life threatening in those with underlying health conditions. In these cases the skin can become dry and hot, with severe headaches, dizziness, fatigue, quicker than normal breathing, fainting and seizures all becoming potentially serious issues. Heat exhaustion and heat cramps, although less severe, are also potential issues - although that doesn’t mean you should instantly dart for a cool air-conditioned building either. Stepping directly from the outside heat into the cool surroundings of an air-conditioned shop, workplace or home makes it easier for viruses to spread, whilst it has also been linked to joint and muscle pain. As a result, the UAE’s Ministry of Health has issued advice on how to avoid any potential issues; this includes avoiding leaving children in vehicles, always ensuring that you are properly hydrated and wearing loose, lightweight clothing. The intense heat is expected to last until late August, when temperatures should return to more bearable levels. Despite the incredibly hot summers, the UAE remains one of the most popular locations we work with. Could a move there be right for you? Register on our website today to start your journey. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdcvmdmvmtmvmtmvntmvntk1l09tyw5ozxdzlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

July 19 Oman News Roundup

Healthcare Excellence Recognised A number of Oman’s leading private healthcare private healthcare facilities have been recognised and rewarded at an awards ceremony held this week. According to the country’s government, the awards will pay tribute to facilities in the Sultanate that work to the highest possible international standards, whilst boosting the competitive nature of the marketplace to provide outstanding outcomes for patients. Further to this there are also awards for staff and facilities who have been involved in research projects, and those who encourage entrepreneurs to invest in the Sultanate. Given its commitment to healthcare, and enhancing these goals, Oman could be one of the best locations in the region for a longer-term move. Kidney Workshop Oman’s Ministry of Health organised a two-day training workshop on kidney treatment last month. The event was run by the department for non-communicable diseases, in tandem with the Centre for Continual Professional Development and covered a wide range of topics, with guest speakers also giving lecturers on the area being studied. Peritoneal dialysis was one of the biggest focuses, with studies on methodologies and strategies surrounding the technique being brought under the microscope. Further to this, lectures were carried out focusing on how to create a positive learning and teaching environment for young medics, along with how to manage and prevent peritonitis. Kidney issues in Oman appear to be on the rise, with almost 1,700 Omanis affected by related conditions each year. Record Wage Growth Wages in Oman have grown at a faster rate than in any other Arab nation a new report has shown. In the state council’s findings, wages in Oman have grown by 11.4% over the past decade, highlighting the increasing strength of the Sultanate’s finances in a challenging economic climate. Speaking about the findings, Dr Said Al Muharrami of the country’s economic committee, said: “This wage growth is almost twice the increase in salaries when compared to the country that was ranked second in the region, the Kingdom of Saudi Arabia recorded a wage increase of just 6.4% over the corresponding period. The study by the state council did not only look at wages, but also how much the government invests in education, health, and housing in Oman.” He continued: “When it comes to human development, Oman came in as the fifth best Arab country and 48th globally according to the UN's Human Development report for 2018. Oman is working to develop people and make sure they have everything they need to live a good life and help progress the country.” Would you be interested in relocating to the often mysterious Gulf nation of Oman? It certainly has plenty to offer. Simply register on our website and start your Odyssey today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdcvmdmvmtmvmtavmdcvmta1lzvswuzmsu5ams5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Five Reasons to Move to New Zealand

Making a decision on where your future lies can be a daunting prospect, with research often the key to deciding which location is right for you. To try and make things easier we’ve compiled these little guides - each looking at reasons why your future could lie in a select number of locations we work with. Article 6 - Five Reasons Why Your Future Lies in New Zealand 1 - Outstanding Quality of Life New Zealand is famed worldwide for offering one of the highest standards of living available anywhere. In the 2019 Mercer’s Quality of Life Index Auckland, on the North Island, was ranked third out of more than 230 cities worldwide. Only beaten by Vienna in Austria and Zurich in Switzerland. Mercer’s index explores a range of indicators, from a city’s infrastructure to the political and economic stability of the location. This means that it’s considered one of the most accurate guides to a country’s desirability, making New Zealand hugely attractive to anyone looking for a higher quality of life than they currently enjoy. 2 - Potentially Lucrative Salaries Salaries in New Zealand are commonly similar to those in the United Kingdom. GPs can expect to earn between NZ$100,000 and NZ$200,000 (£56,000 - £112,000), whilst this can rise to over NZD$250,000 (£140,000) for experienced consultants. That’s not all though, if you’re prepared to work in a more rural area then salaries will be even higher - with a GP role famously offering a salary of NZ$400,000 to anyone willing to work in a remote location. Rural New Zealand is beautiful, however if you decide to take a job there it’s crucial that you know that travelling may become tiresome - especially when you’re miles from the nearest big city. 3 - Facilities Whether you work in the public or private sector, New Zealand is home to plenty of high quality, modern facilities. Investment has been consistent in recent years, and with the country’s population steadily increasing more hospitals, clinics and surgeries have been opened to ensure that demand is kept up with. Don’t feel that a move to a rural country on the other side of the world will lead to a drop in the quality of your working environment therefore. In fact often the opposite can be true, especially for medics accustomed to working in overcrowded, dated NHS buildings. 4 - Working Hours Working hours in New Zealand are far lower than they are in the NHS, especially for GPs and surgeons working in rural locations. On average GPs will work from 8:30 or 9:00 until 12, and then from 2:00 until 5:00. This can vary depending on your role, and may include travelling to do some work in more rural surgeries. Things are different for surgeons, however the premise remains the same. Lower working hours, and a more family friendly work/life balance. 5 - Productivity New Zealand’s lower working hours appear to be having a positive impact on productivity in the country, with rates seemingly on the increase. Lower working hours within a rewarding environment can help to motivate an employee further, potentially increasing the amount of work a medic can complete - despite them spending less time in their hospital or clinic. Would you be interested in a move to New Zealand? Register on our website today to start your Odyssey. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdcvmdmvmtmvmtyvmzqvnzyvmtlbdxn0cmfsawfozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Cancer Care App in Australia

A team at Deakin University’s School of Medicine and Nursing in Victoria, Australia, have developed a new mobile application for people caring for cancer patients. Known as ‘Carer Guide’, the new app has recently completed a 30 day pilot programme with colorectal cancer patients in the region, and the feedback received was overwhelmingly positive. It is hoped that the technology will allow carers easy access to reliable information, along with a quick way to contact help should it be required in a challenging situation. Usability and accessibility are its two key features, with the team keen to provide software that can be found easily in stressful times, or in more casual moments - such as when waiting on an appointment or travelling on public transport. Although seemingly a relatively simple development in an era where it feels as if there’s an app for almost everything, the team believe that their software will be the very first designed exclusively for people caring for cancer patients. Plans are now in place to trial the app nationally, in order to decide whether or not it could be able to meet Cancer patients needs throughout Australia. What do you think? Could mobile applications help carers of people with long-term health conditions, or will they make little impact? Let us know your views on our social media channels.

W1siziisijiwmtkvmdyvmjyvmtmvmzyvmjivndi5lze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Saudi Arabia June Roundup

Hajj Health Recommendations Saudi Arabia’s Ministry of Health (MoH) has published its recommendations and requirements for those travelling to the country for the annual Hajj pilgrimage. Well over two million people are expected to arrive in the Desert Kingdom from around the world for the event, leading to a greater than usual risk of infectious disease spreading. As always the MoH have put strict protocols in place to try and prevent any issues. Anyone travelling from a location where they are at risk of Yellow Fever must have a valid Yellow Fever Vaccination Certificate, whilst visitors also need to have had a meningococcal vaccine administered at least ten days prior to their arrival in the country. Polio and seasonal influenza are also areas of concern, with the Ministry publishing advice for travellers to follow to reduce the risk of infection spreading: From using disposable tissues to avoiding consuming unpasteurized milk. Latest MERS Figures 14 cases of Middle Eastern Respiratory Syndrome (MERS-CoV) were reported in Saudi Arabia last month, with four being fatal. MERS is a viral respiratory disease caused by a novel coronavirus that was first identified as a major issue in Saudi Arabia over four years ago. It is believed to be transported by camels, however the exact science behind this factor still remains unknown. This also means that it is untreatable, with around 36% of patients suffering from the condition dying as a result of it. Typically the symptoms can range from a simple fever like cough, to shortness of breath and diarrhoea, whilst in patients with long term health conditions such as Cancer and Diabetes the side effects can be far more debilitating. Despite the loss of life however, the World Health Organisation believe that proactive measures taken by the Saudi Ministry of Health have been effective in preventing a much larger outbreak. Healthcare Workforce Grows Saudi Arabia is now home to almost half a million healthcare workers according to the latest figures, including 104,759 Saudi and non-Saudi doctors and dentists. According to the Ministry of Health’s figures, 88,023 doctors are currently in the Desert Kingdom - with 28,865 non-Saudis working for the country’s Ministry of Health, compared with 16,706 natives. In the private sector the split was even more stark, with over 22,000 of the 24,000 medics employed being from overseas - showing that the largest number of opportunities for doctors remains in the private system. The statistics were similar in dentistry, with 9,465 of the 11,184 working in the private sector being expats, whilst Saudi nationals made up the majority of the small public system. Would you be interested in a life changing move to Saudi Arabia? We’ve got an exciting range of roles on offer on our website, simply register and start your journey today. Your dream job could be closer than you might imagine.

W1siziisijiwmtkvmdyvmjyvmtmvmzivmjkvoda3lze5tlpozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Indigenous Smoking in New Zealand

New Zealand’s Health Research Council is aiming to reduce smoking rates in indigenous groups, thanks to a new $4.95m grant. As the country pushes towards hugely ambitious plans to be smoke-free by 2025, the higher than average smoking rates among Maori and Pasifika people have been targeted, with the funding given to a partnership spearheaded by Otago University. Lizzie Strickett will lead the research team for the new programme, known as Hāpai te Hauora, and she highlighted how vital it is to reduce smoking rates in the indegenous population. She said: “Given that we’re losing 5,000 whānau members a year to tobacco related illness, I would say this research is more than important, it is essential.” “We’ve been privileged enough to be welcomed into the homes and marae of whānau who have shared such innovative and thoughtful solutions on how to get there, and think this research will be one way in which we can translate their whakaaro into action.” Working directly with members of the community to create a tailored programme is a key way in which the new scheme hopes to reduce smoking rates, something that was further highlighted by Andrew Waa of Otago University. He added: “From a Māori perspective, we need to better understand what is causing smoking disparities to exist and what we can do from a policy perspective. We also need to engage and support the group from a community perspective.” Will New Zealand’s approach to targeting indegenous smoking rates be a successful one, or is the country fighting a battle it’s unlikely to win? Let us know your views on our social media channels.

W1siziisijiwmtkvmdyvmjyvmtmvndcvmjavnjgylzvswuzmsvvbrs5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

5 Reasons to Move to the UAE

Making a decision on where your future lies can be a daunting prospect, with research often the key to deciding which location is right for you. To try and make things easier we’ve compiled these little guides - each looking at reasons why your future could lie in a select number of locations we work with. Article 5 - Five Reasons Why Your Future Lies in the United Arab Emirates 1 - Healthcare is a Societal Pillar Whilst much of the press coverage around the UAE’s current financial situation is focused on the slow down of the global oil price, attention in the Emirates is closely focused on driving the country’s economy forward - and healthcare has become a key player in this. The UAE is determined to make the country home to the highest quality healthcare sector in the Middle East, further boosting its reputation as a major health tourism destination - whilst attracting the highest possible calibre of medical professionals. As a result there are plenty of cutting-edge new facilities, whilst healthcare providers are always striving to outdo their immediate competition. 2 - Ten Year Visa The UAE recently introduced a ten-year visa, in an attempt to grow its attraction to some of the world’s leading specialists in a range of key industries. The criteria is strict, aimed at singling out the specialist talent the country requires. As a result the system will be open to investors, and specialists in the medical, scientific, technical, research and engineering fields. There are two main reasons for the new visa system’s introduction at this moment in time. Firstly the Emirates are keen to continue developing areas away from oil, and this makes it vital that it attracts the world’s leading talent in other fields. By offering long-term security, high wages and the opportunity to shape the country’s future, hopes are high that a move will be too attractive for many to turn down. The second reason is far simpler. If people have the security of a long-term future in the country then they should be more inclined to invest in property, giving the slow market a much needed boost. 3 - Tax Free Income It goes without saying that finances can be a major attraction to the United Arab Emirates, with the country renowned worldwide for offering a tax-free income. On top of this accommodation and education allowances can make a move extremely rewarding. Despite this however it is worth considering the cost of living - especially in the major hubs of Dubai and Abu Dhabi. Prices can be around 30% higher than in London, so before committing to a relocation it’s worth considering the overall cost of living, not just the benefits of a tax-free salary. 4 - Professional Opportunities The UAE is a great location for anyone keen to develop themselves professionally - and not just thanks to the high quality of medical facilities on offer. As it continues to strive for medical excellence, the Emirates has placed a real focus on hosting high quality conferences and investing in research. Combined these can allow you to meet and network with key players from the global healthcare industry, compare research findings and work on exciting new projects. Some people fear that a move to the UAE may lead to them becoming deskilled, however that needn’t be a concern. 5 - High Quality of Life Whilst admittedly often coming at a cost, the United Arab Emirates does offer an extremely high quality of life. From luxurious compound villas, to impressive high-rise apartments, the Emirates (especially Dubai and Abu Dhabi) know how to do luxury. Dubai is also regularly ranked as one of the top five locations globally to call home, whilst the Emirates as a whole normally comes well inside the top ten in HSBC’s annual ‘ExpatExplorer’ report. If you’re looking for a better quality of life then the UAE can be a great place to call home. Would you be interested in a move to the United Arab Emirates? Register on our website today and start your Odyssey. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdyvmtivmtmvmdgvntkvmta3lze5q2fuywrhrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Culture Shock Cures - Canada

‘Culture Shock’ can be a major factor in preventing expats from getting the most out of their new life overseas. Defined as: “The feeling of disorientation experienced by someone when they are suddenly subjected to an unfamiliar culture, way of life, or set of attitudes”, it’s something that will have been experienced in some degree by anyone who has previously taken their career to a foreign environment. In order to try and help you and your family work through the symptoms, we’ve taken a look at the most common factors likely to affect you in each country we work with, and how to combat them. After all, preparation can be the key. The Weather One of the first things that many expats will notice about Canada is just how extreme the weather can be. In summer temperatures can reach 30°C, whilst in the winter they can drop to -25°C in the same location. This can take a lot of getting used to, and also means that you have to be prepared for both situations. Houses are commonly built to keep the heat in, and this means that they can get especially warm during the summer months. As a result you’ll probably want to make sure that your home has strong air-conditioning, and heating! Top Tip: It is easier to settle into your new surroundings during the summer, so try and schedule your move between March and October to avoid a serious shock. Make sure that your house is appropriately built to keep the heat in during winter, and remains cool during summer...and bring two completely different wardrobes of clothing! Few countries on earth allow you to wear shorts and T-Shirts almost throughout summer, and layer upon layer of thermal jackets during winter. Language Two languages are widely spoken in Canada, English and French. Being fluent in one of these is essential if you’re making a move, however being strong in both can play a major role in removing one of the most common areas of culture shock experienced by expats. French is the number one language in Quebec, Eastern Ontario and New Brunswick and, whilst most people are bi-lingual, a knowledge of the language will help things feel far less alien to you. Top Tip: Brush up on some basic French before you apply, especially if you are moving to a predominantly French speaking area. Not only will this help you feel more at home, it will also be looked upon very favourably by employers. Taxation The way taxation works in Canada is slightly different to most other countries, and this is especially noticeable when you’re doing your grocery shopping. Very few shops will include VAT on the price tickets, and this can leave you with a larger than expected bill when it comes to payment. This can be extremely frustrating, especially early on, and can leave expats in the country feeling out of pocket. Tax rates in the country are similar to those in the UK, but far higher than in the Middle East, so few people move to the country solely for financial reasons.. Top Tip: Do your sums prior to a move to work out if you’ll be better (or worse) off in the country. That way you’ll avoid any nasty surprises when you receive your first paycheque! Would you be interested in a lifechanging move to Canada? Register on our website today and start your Odyssey. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdyvmtivmtmvmjuvndkvnja5l1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

UAE Government to Boost Life Quality

The United Arab Emirates’ Government has launched a new programme aimed at improving the quality of life of everyone living in the country. Known as the ‘National Strategy for Wellbeing 2031’ the 12 year long campaign will see over 90 new projects introduced that are aimed at improving the; ‘physical, psychological and digital health of future generations.’ The programme will be split into three categories: Individuals, society and country - with each containing components and objectives that should allow residents and citizens to live healthier and more fulfilling lives in the Emirates. A pioneering National Wellbeing Observatory will also be set to regularly monitor and report on the health of the nation, with a focus placed on encouraging healthy lifestyles, tackling mental illness and encouraging those in the country to start to adopt a more positive outlook on life. Further to this the new campaign aims to stress the importance of strong family connections, and is hopeful that it will be able to increase the attractiveness of cities throughout the nation to overseas workers. In spite of the oil-price slowdown, the UAE remains an extremely attractive destination to call home. Both the public and private medical sector are home to some high class facilities, whilst salaries and the standard of living remains high. To find out more register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdyvmtivmtmvmjcvndivnjcwlze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Psychiatric Funding Boost in Australia

Australian Prime Minister, Scott Morrison, has pledged AU$2.8m towards a youth mental health group, in an attempt to help ‘break the curse’ of youth suicide. Recent figures suggest that around a quarter of Aussies between the ages of 16 and 24 experience mental health issues annually, whilst suicide is now the leading cause of detah for those between the ages of 16 and 44. The additional funding comes after mental health support was placed at the heart of the recent election campaign, with Morrison promising to spend more than AU$42m on mental health causes if elected. Charity ‘batyr Australia’ will be the beneficiaries of the first financial boost with the group, launched in 2011 and named after Kazakh speaking elephant ‘batyr’ aiming to give a voice to the elephant in the room - mental illness. Their mission statement involves smashing the stigma surrounding mental health by creating communities that support young people, and encourage them to seek help when needed - after figures showed that seven in every 30 Australian students will experience mental health issues, but only two of the seven will seek support. The announcement comes at a time when mental health is very much at the top of Australia’s agenda, after a recently published report showed that around 45 men take their own lives every single week. This figure is far from the most shocking however, with the suicide rate in young males under the age of 15 rising by 77% in 2017. Could you help Australia as the country battles with sky-high suicide rates? The country is always on the lookout for highly trained psychiatrists - meaning a dream move ‘down under’ could be far closer than you might imagine. Register on our website today for job alerts and start your Odyssey today.

W1siziisijiwmtkvmdyvmtivmtmvmjivmjqvmzywlzvswuzmsuttqsaomskucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Your Future in Australia

Making a decision on where your future lies can be a daunting prospect, with research often the key to deciding which location is right for you. To try and make things easier we’ve compiled these little guides - each looking at reasons why your future could lie in a selected number of locations we work with. Article 4 - Five Reasons Why Your Future Lies in Australia 1 - Fantastic Employment Opportunities Australia has had a steady demand for medical professionals for a number of years now, with GPs, internal medicine specialists and psychiatrists especially in demand. That makes it the ideal location for someone looking to make a real difference, and secure a life changing move overseas quickly. Clearing immigration in Australia can be an arduous process, unless you have the skills and a job offer - in which case the country makes it easy to complete the move. 2 - Great Environment Whether you’re moving alone or with your family, Australia provides the perfect location to call home. If natural beauty is your thing then the country is home to miles of perfect beaches, and unspoilt countryside. For those seeking a quicker-paced city lifestyle, modern metropolis like Perth, Sydney and Melbourne are fantastic places to call home - far less packed than most European cities, and with plenty of green spaces and excellent air quality, Australia is a wonderful place to call home. 3 - Multicultural Environment Incredibly almost half of Australia’s population do not have Australian grandparents, with the country having attracted settlers from throughout Europe, Asia and the Americas for generations. This makes it a rich cultural melting pot, with a diverse culture - and all the benefits that go with that. 4 - Work/Life Balance As well as being home to a fantastic environment and plenty of employment opportunities, Australia is also renowned worldwide for the excellent work/life balance enjoyed by workers in the country. Employers place a real focus on ensuring that their staff maintain a healthy balance between their careers and private lives - and this can make a real difference to medics feeling overworked and underappreciated in the UK’s NHS. 5 - Healthcare System Whilst it will come as little surprise, the healthcare system in Australia is considered one of the best in the world. Facilities are modern, well equipped and well staffed - whilst the range of services offered is continuing to grow - with the country at the forefront of many new research and development initiatives. If you’re concerned that a move overseas could lead to you becoming deskilled then Australia is the ideal location - as this won’t be an issue. Would you be interested in living and working in Australia? Register on our website today and take the first steps on your Odyssey. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdyvmduvmtmvmjyvmjkvmje1lze5q2hpbmfozxdzicgxks5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Diabetes and Cancer Links Explored

Researchers in China has shown that a link exists between type-2 diabetes and Cancer, however it seems to affect males and females very differently. According to the findings, which were compiled over a three year period by a team of medics from the Shanghai Jiao Tang University of Medicine, and studied more than 400,000 adults between the ages of 20 and 99 with diabetes, males with the condition had a 34% greater chance of being diagnosed with Cancer, whilst the risk rate for females was 62% higher. Perhaps their most insightful finding however was that males with diabetes had an 86% greater risk of prostate cancer than non-diabetics. For females with diabetes meanwhile the risk of nasopharyngeal cancer was far higher, whilst the chances of developing cancer of the liver, esophagus, thyroid, lungs, and pancreas, as well as lymphoma, uterine cancer, colorectal cancer, leukemia, breast cancer, cervical cancer, and stomach cancer were also far greater. Interestingly however the risk of developing gallbladder cancer was actually lower in diabetic females than it was in non-diabetics, although it’s not known if a clear link is able to be established there. The final research paper, published in the journal of diabetes, shows that China can expect to see a growth in the number of cases of diabetes related cancer - with the country’s prevalence of diabetics and pre-diabetics officially classified as ‘very high’ in the latest data. Paying tribute to Shanghai’s advanced data gathering database, co-author Bin Cui, said: “The Shanghai Hospital Link Center has collected clinical information from the main general and specialized hospitals and created a centralized data repository for all residents in Shanghai since 2013. “Based on this our research could be carried out smoothly and efficiently.” Would you be interested in helping China as the country works to rapidly develop its healthcare sector? Register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdyvmduvmtmvmjmvmjuvnjkzlze5q2fuywrhrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Residency Pilot Project in Canada

A move to Canada could now be easier than ever thanks to a new pilot project that allows rural provinces to easily hire overseas talent. The Atlantic Immigration Pilot Project allows employers in Canada’s four Atlantic provinces (Nova Scotia, New Brunswick, Newfoundland and Labrador and Prince Edward Island) to employ skilled workers, providing a simple pathway to permanent residency in the country. Odyssey Recruitment understands that some medical facilities have taken advantage of the program, potentially opening the door to a long-term move in just six months. Here’s a quick look at how the system works. Meeting the Requirements To meet the requirements as a highly skilled worker you must: Have worked in a professional role within your area for at least one full year. Have a high school diploma (or equivalent). For medical professionals this will not be an issue. Be capable of passing a language test to prove that you are an effective communicator in either English or French. Prove that you will be able to support yourself (and any dependents) financially. The Next Steps You must receive a concrete job offer from an organisation registered on the program in order to take advantage of the scheme. You cannot apply in advance of receiving a job offer. This is where we can help. If you are keen on a long-term move to Canada then we can liaise with the employer to uncover whether or not they are part of the program. Getting Organised We cannot stress enough just how important it is to be organised in advance of a move - and this is no different if you’re heading to Canada on the Atlantic Immigration Pilot. Everyone applying must complete a language test - even if you studied in Canada. Further to this you’ll need an English credentials relate your qualifications to Canadian standards. A proof of funds is also required in order to confirm that you will be able to support your family, whilst every role will ask for a range of more specific work-related documentation. Before applying try and have qualifications, board memberships and any additional training certificates organised and ready to send. Confirmation After this you should be able to submit your details and complete your application. Somes roles may require biometric scanning or photographic ID, however this aside you should be good to go. Interested? Register on our website today. Job opportunities in Canada don’t come up all that often, and are usually in high-demand, however we can help ensure you give yourself the best chance possible of securing a dream role in the country.

W1siziisijiwmtkvmdyvmduvmtmvmjavmtevnjq3lzvswuzmsuttqs5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Your Future in Saudi Arabia

Making a decision on where your future lies can be a daunting prospect, with research often the key to deciding which location is right for you. To try and make things easier we’ve compiled these little guides - each looking at reasons why your future could lie in a selected number of locations we work with. Article 2 - Five Reasons Why Your Future Lies in Saudi Arabia 1 - Stability Whilst various other parts of the Gulf region are experiencing economic slowdown as a result of the oil-price drop, Saudi Arabia remains home to one of the most stable financial sectors in the Middle East. That means that, whilst facilities in previously thriving hubs like Dubai, are cutting staff numbers as demand drops, many facilities in Saudi are actually doing the opposite. The future looks bright. 2 - Outstanding Facilities Outsiders may have the image of Saudi Arabia as a dusty, somewhat backwards location. However that couldn’t be further from the truth. The Desert Kingdom is home to a number of Joint Commission International (JCI) accredited facilities - all of which offer high Western standards of care to their patients. If you’re concerned that a move to Saudi Arabia could be like taking a step back in time then don’t fret. We only work with facilities that can prove they operate to the highest possible standards. 3 - Growth of Liberal Beliefs Saudi Arabia is known, somewhat infamously, for a range of strict rules and laws that restrict the freedom of everyday life. Gradually however these are lifting, and the Kingdom is becoming increasingly liberal. The famed ban on female drivers has been lifted, whilst the Religious Police no longer have the power they once did. Laws (and punishments for breaking them) are still strict by Western standards, but attitudes are changing. 4 - Financial Rewards It goes without saying that a move to Saudi Arabia can be extremely financially rewarding. Not only does the Kingdom offer some of the highest tax-free salaries for medics available anywhere in the world, the cost of living is also low - whilst many employers will provide accommodation and transport. Even spending just five years in the country can boost your financial outlook hugely, potentially making a move an extremely lucrative one for someone keen for long-term financial security. 5 - High Standard of Living Of course life in Saudi Arabia doesn’t have to be too frugal and, for not a lot of outlay, you can enjoy a high standard of living. Many expats choose to live in compounds, where they have more freedom to live as they wish - and these can often offer high quality accommodation, plenty of social groups and even on-site restaurants. Furthermore the country is ideally positioned for exploring the rest of the region, so if a few days in Dubai or a quiet weekend in Muscat would be of interest then Saudi Arabia would be perfect. Interested in a move to the Desert Kingdom? Register on our website today for job alerts. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmduvmjkvmtivmjyvndcvotg2lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Australia's Mental Health Crisis Worse Than Feared

New research has revealed that Australia’s mental health crisis could be far worse than previously imagined. According to findings compiled by mental health organisation ‘Beyond Blue’, an average of 82 men daily either attempt suicide, or have had serious thoughts about suicide - with Ambulances attending more than 30,000 of such cases annually. Often Emergency Departments will record just a single reason for a patient’s visit, and frequently the mental health aspect is overlooked in favour of more physical issues. Beyond Blue chair, Julia Gillard, outlined just how concerning the findings are. She said: “This research tells us that suicide-related presentations to our health services by men triple when measured by ambulance data rather than hospital data. It tells us that what we know about male suicide is just the tip of the iceberg. Her concerns were echoed by CEO Georgie Harman, who added: “There is an urgent need for system reform. “In particular, we must stop the revolving door of acute presentations to hospital emergency departments, by valuing and investing more in community-based support and alternative pathways to deal with the immediate crisis.” Could your skills help Australia to deal with this mental health crisis? There’s always a steady demand for Consultant Psychiatrists in the country, meaning that a dream move could be far closer than you might imagine. Register on our website today, to start your Odyssey.

W1siziisijiwmtkvmduvmjkvmtivmjkvmjcvnzqzl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

UAE Psychiatric Stigma Dropping

The stigma surrounding mental illness in the UAE appears to be dropping, with a majority of residents in the Emirates now open to seeking support in the event of a mental health emergency. According to a recently published YouGov survey, 62% of Emiratis would seek help from a medical professional in the event of an issue, whilst just 15% would now keep the problem to themselves. Perhaps the most interesting findings related to what it would take for people to seek assistance - with figures across the board still concerningly low. Data showed that only 62% of people in the Emirates would seek support for suicidal thoughts, dropping 61% if self-harm was involved, and 53% would look for assistance if they were experiencing the symptoms of post-traumatic stress disorder. Whilst these figures were all over half of respondents, those for other conditions remain far lower - with just 36% of people seeking professional assistance for eating disorders, and 43% for bipolar symptoms. That makes incentives, such as Dubai Health Authority’s new programme targeting mental illness warning signs in those under the age of five, all the more vital in ensuring that the stigma drops in years to come. World Health Organisation statistics show that the United Arab Emirates is home to the highest levels of depression in the Gulf region, with over 5% of the population openly suffering from the condition - with actual levels likely to be much higher. Could your skills help the United Arab Emirates as it battles with mental illness? Register on our website today to start your Odyssey. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmduvmjkvmtivmjivmtkvnje5lzvswuzmsu1hbhrhlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

5 Reasons Why Your Future Lies in Malta

Making a decision on where your future lies can be a daunting prospect, with research often the key to deciding which location is right for you. To try and make things a little easier we’ve compiled these little guides - looking at reasons why your future could lie in a selected number of locations we work with. Article 2 - Five Reasons Why Your Future Lies in Malta 1 - Impressive Healthcare It perhaps comes as a surprise that a tiny island like Malta, more famed as a holiday destination, is actually home to one of Europe’s best healthcare systems - but that is absolutely the case, and it’s only likely to improve as the country attempts to attract more medical tourists. Although small in size, the island is home to both public and private facilities - all of which operate to typically high European standards. This makes them ideal for someone seeking a life changing career move - without any stress in the workplace. 2 - English The language barrier can prevent a high number of people from making a move overseas - especially to the Arabic speaking Gulf or China, where different languages are notoriously challenging to learn. Fortunately that shouldn’t be an issue in Malta, with English and Maltese the official languages - and all medical centres working in English. That does mean that fluency will be expected for all roles however - so don’t apply for an opening if your English isn’t top class. 3 - Great for Training Although we don’t often have training positions on offer in Malta, there is little doubt that the island is a fantastic location for junior doctors to gain experience in a new environment. Strong ties exist between Britain’s NHS and the Maltese healthcare system, whilst the high standards and experienced workforce make it the perfect location for young medics to test themselves. 4 - Safety When was the last time you heard about Malta on the news? You probably can’t remember. The country was recently rated as the world’s second safest, it is home to low crime rates, and unlikely to be seriously affected by natural disasters - making a move a safe and enjoyable prospect. 5 - Finances It goes without saying that a move to Malta (or indeed anywhere in Europe) is unlikely to be as financially lucrative as a move to the Gulf region, however that isn’t to say that it can’t still be financially rewarding. Tax rates are low by European levels, whilst the cost of living is almost half that of London! You’ll be especially impressed by the standard of property available for a far lower cost than in other locations. Would a move to Malta be something that would interest you? Register on our website today and start your Odyssey. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmduvmjivmtmvmjkvndevmtyzlzvswuzmsunoaw5hlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Your Future in China

Making a decision on where your future lies can be a daunting prospect, with research often the key to deciding which location is right for you. To try and make things a little easier we’ve compiled these little guides - looking at reasons why your future could lie in a selected number of locations we work with. Article 1 - Five Reasons Why Your Future Lies in China 1 - Become a Leader Perhaps one of the most appealing aspects of working in China is the opportunity it provides to become a leader. The Chinese healthcare sector is growing at a remarkable rate and, as a result, there is an extremely high demand for skilled, experienced medics to lead the development of new facilities and departments - as well as training the country’s next generation of medical professionals. If you’re interested in having a real say in how a department is founded, or making a lasting impact on the future of healthcare, then China is the perfect location. 2 - Recent Development Over the past 20 or so years China has developed into a real global superpower. Rapid development had lead to large scale immigration and the growth of a new middle class - and, as a result, there is a demand for high quality healthcare. Many of the top facilities operate out of high class, recently built developments - whilst the major expat hubs like Shanghai and Guangzhou are now home to a range of exciting attractions for visitors. 3 - Futureproof Unlike nations in the Gulf region which are often reliant on exports such as oil, a move to China should be relatively futureproof - with the country’s economy looking stable and plenty of exciting plans in place to further enhance healthcare in the future. Asia in general appears likely to be the next continent to experience a real financial boom - with the region already becoming a hub for manufacturing and financial services, however this looks likely to take off in the near future. 4 - Unique Culture The first warning we would have is that China is not an ideal location for a first-time expat. Expect a totally different way of life and plenty of culture shock if you make the move. For those who do feel ready however, China is a superb location to explore. Home to a truly unique and historic culture, it can provide expats with the experience of a lifetime. If exploring new environments is a strong motivation for moving, then China can be absolutely ideal. 5 - Low Cost of Living Aside from the professional and culturally benefits of a move comes the more practical side - the cost of living. Even in the hyper-modern metropolis of Shanghai the cost of living is around half that of London, with plenty of fresh local food and produce available at extremely low prices. Transport, rent and utilities are all far cheaper than they are in most large Western locations and, although salaries aren’t at tax-free Gulf levels, they are still more than enough to afford a very pleasant standard of living. Could China be the right location for you? Register on our website and start your journey today. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmduvmjivmtmvmzuvntgvnzkvmtldyw5hzgfozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Brain Tumour Research in Canada

Canada’s Brain Tumour Foundation has launched a new registry, aimed at lowering the country’s reliance on foreign data. Estimates suggest that, every day, 27 Canadians will be diagnosed with a brain tumour - with figures showing that around 55,000 people in the country are now living with more than 120 different kinds of tumour on the brain. These figures are expected to remain at a similar level until 2021, with Meningioma the most common primary tumour in females and Glioblastoma the most common in males. With rates only likely to increase in the longer-term if nothing else is done, the launch of the first ever Brain Tumour Registry in the country could be coming at a vital time. Speaking about the new system, Professor at the University of Alberta’s School of Public Health, Dr Faith Davis, said: “Our hope is, that by counting every brain tumour in Canada, we will get one step closer to finding the cause of all brain tumours and hopefully prevent them from occurring. “We hope to improve the availability of accurate, complete, and analyzed data of malignant and non-malignant brain tumours in the Canadian population.” By providing data that is more comprehensive than previously available, focused on incidence, prevalence and survival rates, hopes are high that the neuro-oncology research community will be able to recognise trends, potentially reducing rates of the issue for many years to come. Is working in Canada, a country considered by many to be the most friendly on the planet for expats, something that would interest you? Register on our website to start your Odyssey today. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmduvmjivmtmvmzivndyvotu3lze5twfsdgfozxdzlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Development in Malta

Medical centres in Malta are in line for a multi-million Euro boost the country’s government has revealed. Funded by passport sales, €10m will be invested in upgrading the country’s eight health centres and 54 community clinics, in order to enhance the workplace for staff and experience for patients - with the impact likely to stretch throughout the country. Speaking about the programme, Prime Minister Joseph Muscat outlined the Government’s commitment to improving the health of the nation - highlighting the strong link between quality of life, and quality of health. Further to this he also revealed that the Maltese Government are developing plans for two new regional healthcare hubs, at a cost of more than €75m. Politicians and industry leaders in the country are optimistic that these could reduce demand on Malta’s premier Mater Dei Hospital. Despite its image as an idyllic holiday destination Malta can actually be a fantastic career move for medical professionals seeking a new challenge overseas. Visit our country guide to find out more, and register to start your Odyssey today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmduvmtuvmdkvntyvndevodi5lze5s1nbrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Saudi Arabia Needs Dermatologists

We’ve started to notice a growing demand for dermatologists in the Kingdom of Saudi Arabia, potentially making now the ideal time for anyone in the specialty to move to the country. Consultant roles will look for: A Medical Degree from WHO approved school Residency in Dermatology completed in a western country such as USA, Canada, UK, Ireland, Australia, New Zealand or elsewhere with Western European standards. Board Certification/Specialist Registration in Dermatology Minimum 3 years experience as a Consultant after board certification Fluent English communication A clean medical practice license in the jurisdiction of practice Whilst openings for Specialists will be open to candidates with: Specialist board certification in Dermatology that is accepted by the Saudi Council for Health Specialities. A minimum of three years’ experience in the speciality Fluency in English essential, with a knowledge of Arabic being desirable In return most roles in Saudi Arabia will offer: A generous, tax-free salary Tax free performance related bonuses Flights to and from your home destination Some roles will offer housing, or an allowance towards accommodation costs Healthcare cover for you and your family If you’re thinking about applying for a dermatology role in the Kingdom, it can be a good idea to find out more about the conditions you’re likely to be dealing with - so here’s a quick look at the three most common and prevalent. Acne Estimated to affect around 83% of University age Saudis Almost 30% of people wait for a year before seeking professional treatment Can be genetic, with severe cases often affecting various members of the family Adult acne normally affects women during pregnancy Eczema Lifetime prevalence rate of around 20% Affects an estimated 13% of females between the ages of 13 and 24 Genetic and environmental factors are the main reasons for the issue Detergents, antiseptics, some foods, and vegetable, allergens, microorganisms, hot temperatures, stress and hormonal variations have all been linked. Psoriasis Mostly an issue on the knee and elbow There has never been a clear breakthrough as to what causes it 10.8% of cases in children under 13 A quarter of cases in those between 15 and 20 Interested in the roles we have on offer? Click here to view the latest dermatology openings we have in the Kingdom.

W1siziisijiwmtkvmduvmtuvmtivndavndcvmzq1l1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

UAE Cancer Patients Need Support

Cancer specialists are not offering patients enough psychological support according to recently published research in the UAE. Findings issued in the ‘Supportive Care in Cancer’ journal were taken from a survey of more than 200 outpatients from a Cancer centre in Abu Dhabi, showing that medics normally excelled in meeting the physical needs of patients - however little was done to meet the psychological needs. The research team concluded that; “physicians significantly underestimated the unmet psychological supportive care needs of their patients.” This lead to calls being made for more research into the disconnect between the psychological needs of Cancer patients, and the physical factors often focused on by oncologists. Studies have shown that stress and anxiety related to the fear of Cancer care can lead to treatment being less effective, whilst in severe cases medics can develop clinical depression if their psychological symptoms are not dealt with at an early stage. Although concerning in its findings, the report concluded by stressing that new technology could help to make the issues a thing of the past. “Although smartphones and mobile applications are readily available and popular in the region, UAE physicians and healthcare centres have been slow to incorporate electronic services into patient care, and have instead relied primarily on face to face communication”, it said. “The introduction of these technologies into cancer care in the UAE can offer low-cost, confidential, and patient-centred options to improve patients’ access to information and support, enhancing physical and psychological wellbeing and better meeting their needs.” Could you help the UAE as Cancer rates in the country rise? Register on our website today and start your Odyssey. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmduvmtuvmtivmzevmtqvntkwlze5tlpgzwf0dxjllmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

NZ Measles Outbreak Latest

New Zealand’s worrying Measles outbreak is continuing, with a further 20 cases confirmed over the last fortnight. The outbreak has seen the total number of cases diagnosed so far in 2019 reach 135, with 95% of children under the age of 10 with the condition believed to be unvaccinated. The figures across the board for those who were unvaccinated were damning, with just three of the 71 under-19s hospitalised with the condition vaccinated, and a overall figures showing that 86% of cases involved those who had not had the MMR vaccination. A highly infectious viral illness, Measles has largely been eradicated in most Western countries due to the ready availability of the vaccine - with only a small number of cases occurring each year. Unpleasant cold-like symptoms such as sore eyes and a high temperature are common - however young children, teenagers and those with a weakened immune system can find themselves at risk of far more serious complications. New Zealand’s quickly rising figures have brought about concerns that the disease could become established in the country for the first time since 2012. That has lead to some powerful words from Education Minister Chris Hipkins, who said: “I don't believe that kids should be denied their right to an education, particularly if it's a conscious choice by their parents not to immunise. Those kids are the ones who most deserve to learn about science. “Children shouldn't be excluded from their education because their parents are pro-plague.” Is working in New Zealand something that has been an aim of yours for a while? Register today on our website for job alerts - a dream move could be closer than you might imagine.

W1siziisijiwmtkvmduvmdgvmtmvmjmvmdgvotc0lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

New Poll - Half of Australians Drink to Get Drunk

Australia’s annual alcohol poll has revealed that almost half of Aussie drinkers consume alcohol with the intention of getting drunk - despite a majority believing that they are still responsible. According to the research, a staggering six million Australians admitted that they drink alcohol solely to get drunk, yet 90% would classify themselves as ‘responsible drinkers’. The report published a range of findings concerning the public’s knowledge around the issues associated with alcohol, with 78% of people aware that drinking whilst pregnant can damage a fetus, but just 16% aware of the links between alcohol consumption and breast cancer. Some of the most interesting findings meanwhile were related to the public’s support of increasing awareness around the issues linked with alcohol, with 76% of those surveyed supporting cigarette style warnings on the packaging, and 80% saying that alcohol advertising in certain public locations should be banned. Further to this, half of Australians revealed support for the a tax increase on alcoholic drinks, in order to help offset the cost of alcohol on society. Whilst most of the findings illustrated the concerning scale of alcohol related illness, there were some positives - namely the fact that ¾; of those surveyed stated that more should be done to reduce the harm caused by drinking to excess. This is a clear sign that the majority of people are likely to be receptive to any plans aimed at controlling alcohol issues. Speaking about the report, Chairman of the Foundation for Alcohol Research and Education, Michael Thorn, said: “The findings highlight the dangerous lack of clarity about the long-terms risks of drinking alcohol, including mouth, pharynx, larynx, oesophagus, liver and breast cancer. “An overwhelming majority of Australian drinkers consider themselves responsible, yet a high percentage of those consume alcohol to get drunk. “The Poll results clearly demonstrate how ambiguous and subjective the concept of responsible drinking actually is, when 68% of drinkers who consume 11 or more standard drinks on a typical occasion consider themselves responsible.” Is Australia somewhere you’ve considered working? Register on our website today for job alerts from the country - a dream move could be closer than you might imagine.

W1siziisijiwmtkvmduvmdgvmtmvmtqvmzuvmze4l1vbru9izxnpdhltdglnlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to Culture Shock

Preparing for a move overseas? You’ll likely have thought long and hard about your end destination in order to make sure that it’s definitely right for you. No matter how well you’ve researched it however you’ll likely still experience the four stages of Culture Shock - so here’s what to expect, and how to get over the tough times. 1 - The Honeymoon Almost every move starts with the honeymoon period. During this time everything seems magic and you don’t notice the little quirks or differences that will irritate you as time moves along. Much like going on holiday you are blinded by the excitement of the opportunity to spend time in a new environment. During this stage you will be prepared to turn a blind eye to any noticeable differences, preferring instead to focus on what makes you comfortable. 2 - Irritation and Crisis As time moves on however the excitement associated with living in a new location will start to wear off, and you’ll begin focusing on the negatives. Suddenly the language barrier becomes extremely frustrating, you find it difficult to get about and you seriously start to miss everything about your home country - even the rain! At this point homesickness becomes prevalent, and you’ll begin to get irritated by even the smallest things. Stick with it however, because this is the worst stage for most people. 3 - Recovery The turning point. The stage where you decide whether or not you’re going to stick out this life changing move, or give in and return home. To some people the decision is simple, they are finding it impossible to settle and returning is the only way out. Most however see this stage as the opportunity to accept a country for what it is, and start to appreciate the differences - even if they do find them frustrating at times. By this stage you should have a basic knowledge of the language, and are able to find your way about your new location with a bit more confidence. You start to make friends, and generally find yourself settling into the location. 4 - Integration Often described as a more realistic version of the honeymoon stage, the integration stage is where you start to become a more active member of society. You start to meet new people, take part in new activities and are open to the new way of life that living overseas can provide. That’s not to say that it isn’t difficult at times. There will still be challenges, however by this stage you’re prepared to meet them head-on and are excited about the opportunities that lie ahead. Have you experienced culture shock and have advice on how to get over it? Drop us a message on social media and we’ll publish the best on our website.

W1siziisijiwmtkvmduvmdkvmdkvnduvmdevmjm1lze5t2r5c3nleuv4y2x1c2l2zuzlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Ramadan - An Expats Guide

Ramadan, the most holy time in the Islamic year, started last weekend, and it can prove to be quite a shock for expats living in the Middle East. If this is your first year living in an Islamic country, or if you think you might be spending Ramadan 2020 in one, then here’s what to know. When is it? Ramadan 2019 began on May 5, and will conclude on Tuesday June 4. During this time Muslims will fast during daylight hours until the first day of Eid Al Fitr. What does it mean for me if I’m not a Muslim? If you’re living in an Islamic country during Ramadan then it can have a sizeable impact on your everyday life. This can vary depending on whether or not you’re living in an expat compound in Dubai, or a in the bustling city of Jeddah - however either way there are a few rules you should make sure that you follow in public. 1 - Don’t eat in public Whilst Ramadan obviously isn’t mandatory for everyone, it’s best that non-Muslims avoid eating in public during the month. This includes using chewing gum, and when driving your car. Many employers will set aside a special room for non-Muslim employees to have lunch in, however if that isn’t available we’d always recommend speaking to senior management before eating at work. It’s unlikely that you’ll face any issues, as tolerance is heavily preached during the month in most expat locations, however it shows respect for the culture. 2 - Avoid blaring music Almost everyone knows the rules around eating during Ramadan, however far fewer are aware of the customs surrounding music and dancing. Playing music loudly during daylight hours will be frowned upon, and we’d recommend quietly using headphones to get round the issue. If you live in a gated compound then playing music around the house won’t be an problem, however if you’re living in a mainly local neighbourhood it’s best to keep the stereo turned off! 3 - Avoid rush hour Roads in the Middle East can be chaotic at the best of times, however things can get especially hectic during Ramadan. 30 minutes before sunset is generally considered the peak time, with hungry workers frantically trying to make it home to finally break their fast. Having not eaten all day, and with minds turning to food, this can lead to a higher than average rate of accidents, whilst frustration may lead to more aggressive driving techniques being used. If you can, avoid travelling during this time. How else will things change? Ramadan brings far more than just extra rules to the Middle East. 1 - Reduced working hours Across the region most people will work reduced hours during the holy month, with the UAE imposing a maximum six hour day rule on everyone. This isn’t always the case throughout the region, and some employers may expect non-Muslim employees to work as normal, however most will benefit from earlier closing times. Make sure that you plan any shopping trips or administrative appointments around the reduced hours - as things can get hectic. 2 - Alive at night With fasts only allowed to be broken once the sun has set, major cities like Dubai, Riyadh, Doha and Muscat come alive when darkness falls. Restaurants are often booked up well in advance, with families coming together to celebrate the end of the day with a large meal. Depending on the sunset times this can make the city centre a bustling hive of activity in the early hours of the morning. Would you be interested in spending Ramadan 2020 in the Gulf? Register on our website today job alerts. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmduvmdevmtmvmjevmduvnjk1l09kexnzzxlwawrlb250zxj2awv3cy5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Our Guide to Video Interviews

If you’re considering a move overseas then it’s highly likely that a video interview will form part of the recruitment process. Many people see this as a more relaxed and informal way of speaking to a prospective employer, but there are still some rules to follow to ensure that you make the right impression. 1 - Practice It goes without saying that practice makes perfect, however that really is the case when it comes to video interviews. Initially you could feel uncomfortable, remote and lacking attachment with the person on the screen - and that’s why it’s important to practice video interviews in advance. Speaking to a family member, friend or colleague over a service like Skype or Facetime can allow you to spot any potential issues (such as a poor internet connection, harsh lighting or audio problems) and address them without feeling under pressure. Further to this the more time you spend in front of a camera, the more natural it will become. 2 - Dress for success Many people believe that video interviews are less formal than face-to-face meetings, and thus it isn’t as important to look the part - but this belief is incorrect. It’s vital that you create a positive first impression, and being well dressed and presented is key to creating the sort of professional image you want to display. Even if the interview is taking place at an unusual hour or during the weekend, ensure that you are as well turned out as you can be. 3 - Camera friendly When you’re on a video call it’s very easy to fall into the trap of just focusing at the screen when you’re talking. Not only does this feel more natural because you can see who you’re speaking to, it also allows you to gauge their body language. In most computers however this isn’t the best plan, as it will appear as if you are unable to look them in the eye. Instead try and look into the webcam itself as if you’re looking at the person. It will make you appear more genuine and comfortable with what is being discussed. 4 - Be there in advance Just because the interview is taking place in your kitchen doesn’t mean you can turn up bang on the start-time. Video calling can be unreliable with technical issues often disrupting the interview getting underway. As a result we’d recommend being prepared to ‘go live’ at least ten minutes in advance. Make sure that the door is closed to avoid any unwanted visitors, the lighting is right and there are no distracting background sounds. Not only is this good practice, it’s also an excellent way to show your enthusiasm for the role. 5 - Communicate intelligently Communicating over video calls can be difficult at the best of times, so throw in a potential language barrier and the usual nerves of a job interview and it becomes a recipe for a stressful disaster. Speak slowly and clearly to avoid anything being lost as the signal fluctuates. Further to this leave a short gap between the interviewer speaking and you starting - just in case they are going to add anything that has been impacted by a delay on the line. Thinking of furthering your career overseas? Register on our website today to take your first steps. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmduvmdevmtmvmzevmdqvotexl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

UAE Needs to Drop Obesity Stigma

The stigma surrounding obesity is preventing people in the UAE seeking weight loss support, increasing their chances of developing a range of other serious health conditions it has been claimed. Speaking at the European Congress on Obesity in Glasgow, Dr Rita Nawar - who has worked as an endocrinologist in the Emirates for 12 years - explained how many weight-management patients are already diabetic by the time they come to see her. Dr Nawar was speaking having been involved in the Action 10 survey, focused on building the understanding between medics and obese patients. Covering 11 different locations globally, the survey revealed that it normally took six years for overweight people to notice their issue and seek medical assistance, with the stigma associated with obesity often given as a reason for this. Furthermore the report, which is set to be fully published in the summer, should a clear misunderstanding between medics and overweight patients. 70% of medical workers said that they believed obese patients had no interest in losing weight - whilst 93% of those surveyed who were obese expressed a desire to return to a healthy size. Statistics show that a sizeable 68% of people in the UAE are classified as overweight, whilst 32% of this group are obese. These figures are concerning, however not as worrying as those recorded in Kuwait - which show that almost ¾; of adults would be classified as overweight. Speaking at the conference, Dr Nawar explained her plans for reducing the stigma related to obesity. She called on: “A new system that did not classify someone as obese for simply having a certain body mass index, but also recognised being overweight as a chronic disease that needed treatment in the same way as high blood pressure.” Would re-structuring how obesity is thought of be an effective way of helping to manage the issue - or would it make little difference? Let us know via our social media channels.

W1siziisijiwmtkvmduvmdevmtmvmdkvntmvote5lze5qxvzdhjhbglhrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Global Health Issues 2019: Australia

Health issues are always evolving, with each country and continent having its own unique set of challenges. In the latest in our exclusive new series, Global Health Issues, we’ll take a look at each country we work with, and examine what conditions are most prevalent there. In the final article in the series we’re focusing on Australia. One of the world’s most popular expat locations. Coronary Heart Disease Coronary heart disease is one of the world’s biggest killers, and it remains Australia’s biggest single cause of death. Rates in the 1980s were amongst the world's highest, however since then they have been gradually dropping nationwide. The latest detailed statistics on the subject (published in 2015) showed that around one-in-five Australians died either directly because of coronary heart disease, or because of a linked reason. Coronary heart disease occurs when the arteries leading to the heart become blocked by fatty substances. It can be closely linked to a poor diet, smoking, high levels of cholesterol and diabetes and commonly leads to heart attacks. The condition is incurable, however lifestyle alterations such as partaking in more exercise, cutting out fatty foods and quitting smoking can allow a patient to manage it more effectively. Coronary heart disease mainly affects older Australians these days, and rates are dropping amongst younger people as education on the condition continues to improve. For now, however, it remains the country’s biggest healthcare issue. Lung Cancer As with everywhere else in the world at this moment in time, Cancer is one of the biggest issues facing the health of the nation - and in Australia lung Cancer is the form of the condition which causes the most deaths. 85% of lung Cancer cases are caused by the use of (or excessive exposure to) tobacco. Its symptoms can leave patients short of breath, coughing aggressively and even leads to the coughing up of blood if it is not caught at an early stage. Whilst consuming tobacco is the most common contributing factor to lung Cancer, those exposed to chemicals such as radon, asbestos and nickel will also find themselves at an increased risk of the condition. Around 5% of all deaths in Australia each year are as a result of lung Cancer, with the condition manifesting itself in two forms, small cell and non-small cell. Small cell is when the Cancer has not spread to the lymph glands, and this can usually be treated with chemotherapy. In non small cases - where the Cancer has spread further - more powerful chemotherapy or radiotherapy is often combined with surgery to help attempt to remove the Cancerous tumours. The success of these operations can vary depending on the health of the patient, how far the tumours have spread and how early the initial signs were detected. Mental Illness The number of people suffering from mental illnesses globally is on the rise as the stigma is lost and people become more aware of their mental wellbeing. Australia does not buck the global trend. Around 1 in 5 Aussies experience the symptoms of a mental health disorder every year. Anxiety is the most common mental illness in the country, affecting 14.4% of those battling issues, whilst depression was one of the country’s leading causes of suicide. In order to try and help those with mental health issues in the country, and in order to reduce the steadily increasing suicide rate, Australia has invested generously in its mental health services. More information than ever is available for citizens, whilst a range of centres have been opened to allow individuals to speak with specialists about the issues that they are facing. Mental health is now more widely known about than ever before. However a stigma still remains, especially amongst the elderly. With an ageing population Australia faces a difficult task to try and get everyone to speak openly about their mental health. Inequalities Australia is home to a unique group of indigenous people - the Aborigines and Strait Islanders. These people lead a unique way of life that mixes modern technology with ancient traditions. Their lifestyle however is increasingly being seen as unhealthy, with dangerous jobs and smoking highly common, whilst more mainstream, modern, healthcare is shunned by many of the population’s elderly individuals who refuse to trust it. Perhaps unsurprisingly therefore this has lead to the life expectancy for the Aboriginal people dropping to over 10 years lower than the country’s average. The Australian Government has a big task on its hands therefore if it is aiming to work with the Aboriginal people to deal with the all too blatant inequalities that exist in the healthcare they receive. To do this it needs to build up a trusting relationship between the healthcare sector and the Aboriginal community, something that it is currently failing to do. COPD Also linked with smoking and the lungs is Chronic Obstructive Pulmonary Disease, normally referred to as COPD. COPD causes the death of around 220 out of every 100,000 people yearly, and this rate has remained steady over the past 40 years. The condition is common amongst older smokers and former smokers, especially men, and often goes undetected until it becomes more severe. It causes chronic breathlessness as a result of damage done to the lungs, and also puts patients at a higher risk of chest infections. Whilst smoking tobacco is the major cause, inhaling harmful dust or fumes is also a major factor in the development of COPD - especially amongst the elderly population - with new health & safety laws outlawing the working conditions that caused these issues. The damage caused to the lungs by COPD is permanent, and the condition gets progressively worse the longer time goes on. Despite this a mixture of medication, inhalers and exercise routines will keep the lungs performing as well as they can, and should make breathing slightly easier. COPD rates in Australia have remained at a similar level for a long period now, however recent statistics have shown that many young people are turning their backs on tobacco - the main factor causing the illness. It may take time to be proven, however in the future rates should be dramatically lower than they currently are. Could you help Australia battle against any of the conditions outlined here? Register on our website to start your Odyssey today. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdqvmjqvmtmvmjivmtivmjg3lze5u2luz2fwb3jlrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Global Health Issues 2019: Singapore

Health issues are always evolving, with each country and continent having its own unique set of challenges. In the latest in our exclusive new series, Global Health Issues, we’ll take a look at each country we work with, and examine what conditions are most prevalent there. In the penultimate in what’s proving to be a popular series we’re examining the challenges in Singapore - the world’s only island city state. Respiratory Conditions Singapore itself is not actually an overly polluted country, despite its intensely developed nature. This is mainly due to its excellent public transportation system, and high taxes on that deter people from buying vehicles. The main issues arise from neighbouring Malaysia and Indonesia, both of whom still perform outdated ‘slash and burn’ agricultural techniques. This outdated method releases plenty of toxins into the local atmosphere, causing smog, removing the purity of the air and forcing residents to breathe in chemicals which can put them at a much higher risk of conditions such as asthma - with recent statistics showing that as many as 20% of children in the country asthmatic. Whilst many of the respiratory conditions experienced by those in Singapore are fairly minor, the country does have a relatively high rate of lung cancer. Again this can be linked to the slash and burn season, but is more often as a result of smoking tobacco. Unlike in most other countries smoking rates in Singapore have actually risen over the last decade - especially amongst young adults. Those who smoke tobacco find themselves at an 85% higher risk of lung Cancer and, when combined with the poor air quality it can create a toxic combination. Diabetes Diabetes in Singapore is reaching ‘epidemic level’ according to some researchers, with estimates showing that around one in nine people in the country have the condition. It is most common amongst Malays and Indians, with research linking diabetes to a common gene shared by these two groups, rather than directly linking it with the diet in Singapore. In one of the most concerning statistics it is estimated that around 1,200 Singaporeans require an amputation because of Diabetes, with many of these preventable with better management of the condition. Dengue Fever Recent figures have started to show a return of Dengue Fever to Singapore - a viral condition is spread by mosquitoes and is common in countries near the equator. In the majority of cases the symptoms are fairly mild and not dissimilar to a fever (headache, nausea, joint pain etc) however in certain situations it can become far more serious and even life threatening in a small number of cases. Colorectal Cancer Whilst lung Cancer looks as if it will be a big killer in the future in Singapore, the current most common type of Cancer is colorectal. Around 2,300 people are diagnosed with Cancer of the Colon annually, and only around 10% of these cases are due to genetic defects - with the rest being related to lifestyle choices such as smoking and eating fatty foods. Singapore’s hectic way of life can lead to people picking up quick to eat convenience foods that are often high in fat and salt. This can be avoided, and there are plenty of healthy ‘street food’ options becoming available in the country. Colorectal Cancer survival rates are around 84% worldwide, and this figure can increase beyond 90% if it is detected at an early stage. Rates in Singapore have remained fairly consistent for a reasonable period of time now, and the country is playing a leading role in Cancer prevention - in the quest to find a cure for the illness. Myopia Vision concerns in Singapore are a big issue, especially amongst young children. Recent statistics have shown that at least 30% of five year old children in the country have issues with their eyesight, and this figure can rise as high as 60% by secondary education. Genetically those of Chinese origin are at a higher risk of Myopia (more commonly referred to as short-sightedness), and the extensive use of modern equipment like video games and mobile phones is further increasing these risks. Whilst an easily solved issue with glasses, contact lenses or laser eye surgery, the government is doing more to try and drastically lower the amount of young people experiencing issues with their vision. Encouraging children not to read with texts close to their face, or whilst lying down is important; as is encouraging other recreational activities that don’t involve looking at a screen. Given the role that technology already plays in our daily life however, the chances of this figure dropping in the future are looking slim. Would you be interested in a move too Singapore? Job opportunities are rare and highly sought after, so register on our website today to get ahead of the rest. A dream role could be closer than you might imagine.

W1siziisijiwmtkvmdqvmjqvmtmvmzmvntivmzu3l1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Stress Impacting Cardio Health in UAE

Workplace stress is affecting the health of people globally, with high rates of hypertension and heart disease heavily linked to the issue in the United Arab Emirates. According to the research, which was compiled by Cigna Health Insurance, workplace stress is on the rise globally - with 88% of women and 85% of men saying that they found their employment stressful. This figure has also risen in the UAE, from 35% to 45% over the past 12 months. Many reasons were given for the alarming global statistics; from a lack of sleep and exercise, to personal finance concerns and an overpowering workload. In the Emirates this is now manifesting itself in other ways, with links being made between high stress working environments and already rising issues with cardiovascular health in the country. Speaking about the results, CEO of Cigna in the MENA region, Jerome Droesch, said: “The survey was based on five parameters of wellness - physical, social, family, financial and workplace health. The results were more like Key Performance Indicators that the community could use to create greater awareness and help companies adopt workplace wellness programmes to benefit the sandwich generation (those between 35-49). 62% of people fall in the bracket and have to care for young ones as well as aging parents and have greater financial and workplace pressure.” Greater employer support has also been highlighted as a major way in which the Emirates could tackle these issues, with 78% of women feeling as if wellness programmes in their workplace needed to provide equal access for both genders. Droesch continued: “Companies in the UAE must study key gaps in employer support, and concentrate on these in order to lower stress levels. “Flexible work arrangements, special paid leave, time off for personal interests and job security are just some of the benefits respondents feel employers should provide.” Could your skills help the UAE deal with the medical complications associated with rising stress rates? If they could, or you’re otherwise interested in a move to the Emirates, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdqvmjqvmtmvmzevmtuvmjgwlze5tlpozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Medics Back Vapes in New Zealand

The majority of healthcare professionals in New Zealand would support the use of electronic vaping products as an alternative to cigarettes - assuming that they were regulated appropriately. Global analysts Frost & Sullivan spoke to 60 medical professionals - ranging from GPs to Psychiatrists, Surgeons and Allied Professionals - in the country to gauge their views on the greater use of electronic cigarette products. The use of these devices has been controversial, with some researchers arguing that they appeal to a younger market, and the fact little is known about the long-term health impact of using them, whilst others simply see them as a less harmful way of smoking. According to the report 65% of Medics agreed that they would prefer if smokers who are unwilling to quit switched to e-vapes, whilst just 2% disagreed with this. Discussing the findings, MD of Frost and Sullivan in New Zealand, Mark Dougan, said: “Smoking is still a key area of concern amongst healthcare professionals, with 90% believing that the government still needs to do more to address smoking. “Our survey indicates that 60% of smokers overall and 64% of Māori smokers would like to quit, but are facing challenges in doing so, with current smokers who have tried to quit reporting an average of over six unsuccessful attempts to do so. “About 40% of smokers do not wish to quit or are not sure. In this case, switching to tobacco harm reduction products is a better option in the long term than continuing to smoke cigarettes.” Could electronic vaping products help New Zealand to reach its goal of being smokefree by 2025, or do they simply transfer the problem? Let us know via our social media channels.

W1siziisijiwmtkvmdqvmtcvmtivmtmvmjcvotm3lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Improving Youth Mental Health in Australia

Improving the mental health of young people in Australia will improve the nation’s economic prosperity a new report has claimed. The joint inquiry carried out by Orygen and Headspace has made a total of 17 recommendations after it was revealed that mental illness can have a sizeable impact on an individual’s developmental milestones. These have been refined into five key areas, with success in each of these providing a sizeable boost to the mental health of young people in the country - as well as helping to further grow the economy. According to the report the five aims are: To increase access to effective mental health services and support for young people across all stages of mental ill-health. To improve education and workforce participation for young people with mental illnesses. To reduce self-harm and suicide-related behaviours in young people. To build a youth mental health workforce to meet current and future needs. To drive improvements through research, data, and outcome monitoring. Speaking about the findings, CEO of Headspace, one of Australia’s biggest non-profit mental health foundations, Jason Trethowan said: “The experience and impact of mental ill-health during this life stage can derail key developmental milestones and significantly increase the risk of poor health, social, educational and employment outcomes. “The human and economic impact then lasts for decades, right through what should be the prime years of productivity and economic participation. If you look at the total number of Australians to experience mental ill-health throughout their lifetime, half of them will have have experienced the onset by the time they’re just 14-years-old. Could you help Australia as the country battles with sky-high youth mental health rates? If you would like to make a real difference in the country register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdqvmtcvmtivmtavndevnjiylze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

40% of Saudis Now Obese

Saudi Arabia has launched a major new health campaign targeting two key areas, after it was revealed that 40% of citizens in the Kingdom are obese. Diabetes and high blood pressure are set to be the main areas targeted, with the country now home to an estimated 3.8 million diabetics - almost 20% of the total population. Saudi Arabia’s increasingly unhealthy diet and a lack of exercise participation have been given as the major reasons behind these figures,, with further worrying statistics showing that 45% of deaths in the country are due to heart disease, and that 15% of adults in the Kingdom have high blood pressure. With 70% of diabetics also having high blood pressure, hypertension has been labelled as the country’s ‘silent killer’, with work now underway to increase awareness of the condition. A new campaign will allow people to be checked, free of charge, for hypertension and diabetes in commercial centres and malls nationwide, with health officials optimistic that this will allow more to enjoy a better quality of life - with issues being caught at an early stage. Head of the Paediatric Kidney Unit at Al-Qatif Central Hospital, Saleh Al-Shurafa, said: “The campaign aims primarily at raising awareness and shedding light on the importance of early detection and lifestyle modification, especially since the prevalence of high blood pressure is 15% in adults in Saudi Arabia. “70% of diabetics around the world had high blood pressure, and that is why the Ministry of Health set controlling blood pressure and diabetes as a priority in their programs. The correlation between the two diseases makes it necessary to fight both diseases in parallel, as this will help to avoid many complications, as well as the need to stimulate those in society to live a healthy and sustainable life.” Would a move to the secretive and historic Desert Kingdom of Saudi Arabia be something that would interest you? If it would, register on our website today - a dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdqvmtgvmdkvmdqvmtmvode2l0distiwmtlfie1hbhrhlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Global Health Issues 2019: Malta

Health issues are always evolving, with each country and continent having its own unique set of challenges. In the latest in our exclusive new series, Global Health Issues, we’ll take a look at each country we work with, and examine what conditions are most prevalent there. In the sixth article in what’s proving to be a popular series we’re examining the state of health in Malta - a little island that is full of big opportunities for medical professionals. Cardiovascular Disease As with the rest of the world, Malta is facing a sizeable battle with cardiovascular disease - with people in the country now at the highest risk in Europe of dying from the condition. Malta’s historically high smoking rate has been identified as a major reason for this, whilst the country’s adult obesity rate also lends itself to rising rates of cardiovascular conditions. Despite the pleasant climate and fresh, healthy Mediterranean diet it remains the most common cause of death on the island. Childhood Obesity This perhaps comes as more of a surprise, and hints that Malta’s battle with Cardiovascular Disease could be here to stay for the long-term. Malta is home to one of the highest childhood obesity rates in the world - at around 40% - with those between the ages of five and eight the most ‘at risk’ group. In response the Maltese Government have introduced guidelines around portion control for different age groups, whilst they are looking to promote healthy, more active lifestyles for children in the area. Parkinson’s Disease Parkinson’s Disease rates in Malta are some of the highest globally, with it ranked seventh for prevalence of the debilitating neurodegenerative condition. Those suffering find themselves with a tremor, make involuntary movements and experience stiff and inflexible muscles. It is estimated that there are almost 1,500 cases of Parkinson’s diagnosed in Malta, and more that are yet to be discovered. Little is known about the condition, with no cure available. Diabetes Completing a hat-trick of lifestyle related health conditions is Diabetes - with Malta again home to one of the highest rates of the condition in Europe. Concerning statistics published late last year have shown that 45% of the country’s population are likely to be battling the condition by 2045 - whilst figures currently sit at around one in eight. With childhood obesity appearing to be on the rise, it looks as if Diabetes will remain a major challenge in Malta for years to come. Dental Decay Dental decay is fast becoming a major issue in Malta - especially on the island of Gozo. Recently published research studied 332 patients at a mobile clinic on the island, with the findings showing that 78% of patients required restorative treatment in their gums, whilst two-thirds of those over the age of 20 were missing teeth. Taking a more general look at oral health in the nation, the researchers found that children’s dental health in Malta is fast deteriorating - with a rise in tooth erosion noted especially in pre and primary school children. Much of the blame for this has been placed on carbonated and sugary soft drinks which are often targeted at this market. Is Malta somewhere that you had considered moving? We’ve got a small number of opportunities available on our website, and are anticipating many more over the coming months. Register today to get ahead of the rest - a dream move could be closer than you might imagine.

W1siziisijiwmtkvmdqvmtavmtivmzevmzyvnjmzl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Robotic Orthopaedics in UAE

An Emirati man has become the first person to undergo robotic knee replacement surgery at a public hospital in the United Arab Emirates. Made possible by advancements in both technology and training, 61 year-old Khamis Al Khansoori, a patient at Sheikh Khalifa Medical City in Abu Dhabi was the first to benefit. Due to the less invasive nature of the procedure, the former Policeman should be discharged within three days of the operation. Using technology that costs in excess of $2m, surgeons are given a three-dimensional image of a patient’s body, with a console based control system then used to move tiny surgical instruments held by a robotic hand. Speaking after the procedure, Consultant Orthopaedic surgeon, Dr Yaaqoub Al Hammadi, outlined his hopes for the future of robotic surgery in the Emirates. He said: “This is the beginning of the future” “There will come a day in the medical field where every procedure will be assisted by artificial intelligence. It gives you better accuracy and consistency. There are those who don’t want change maybe because of the requirement to retrain and enter new courses, however change is inevitable and should be encouraged.” He continued: “The aim is to give this service to everybody, you can’t put a value on better patient outcomes.” Is Dr Al Hammadi correct that robotic surgery is the future of orthopaedics? Let us know your views via our social media channels. For more information on working in the United Arab Emirates, and the latest job alerts, register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdqvmtavmtivmjmvntqvmjqzl1vbruzlyxr1cmuucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Global Health Issues 2019: United Arab Emirates

Health issues are always evolving, with each country and continent having its own unique set of challenges. In the latest in our exclusive new series, Global Health Issues, we’ll take a look at each country we work with, and examine what conditions are most prevalent there. In the fifth article in this series we’re examining the state of health in the United Arab Emirates - a country that remains highly popular with expat medics, with healthcare proving to be a key way in which the country is attempting to drive its previously oil-centric economy forward. Obesity It will come as little surprise to anyone who knows the region that Obesity is a massive issue in the Emirates. The UAE’s battle with the bulge is showing no signs of being won, as the country continues to expand both in numbers and size. Recent estimates have shown that almost 70% of the Emirates’ population are at an unhealthy weight, with this being blamed on rapid development and a lack of education about a healthy lifestyle. Sporting facilities are becoming more widespread across the country, whilst attitudes are changing as people begin to learn about the major issues that result from being obese - however this will take time. For now obesity can be linked to most of the major health problems in the United Arab Emirates - as well as more generally throughout the Gulf. Diabetes Hand-in-hand with obesity is Diabetes. Across the Gulf region it is a major issue, with traditional diets and lifestyles leading to a population that eats plenty - whilst not exercising or restricting the amount of food that they consume. This has led to a diabetes epidemic throughout the Gulf, and it isn’t a bigger issue anywhere than in the Emirates. Currently over 800,000 people in the UAE have diabetes, and this figure is expected to rise by around 80% throughout the Middle East & North Africa region - potentially affecting an estimated 68m people by 2035. Colorectal Cancer Colorectal Cancer is one of the most common types of the condition amongst men in the UAE, with rates in Abu Dhabi being especially high. Globally it is men between the ages of 60 and 70 who find themselves at the highest risk of the condition, however in the UAE it has been discovered in many men under the age of 40. Around 11% of Cancers in the UAE are Colorectal, with the limited symptoms making it difficult to catch at an early stage. As a result health experts within the country have recommended that men, especially those at a higher risk of the condition due to family history, or factors such as smoking, regularly get screened to ensure it is caught before it can develop. Lymphomas Cancer of the Lymphatic system appears to be on the rise in the UAE, with the country now being home to the world’s ninth highest rates of the condition. Unfortunately the reasons for this remain unknown, with various experts pointing to a range of factors from exposure to radiation, to family genetics. Lymphoma develops when lymphocytes (the body’s white blood cells that help to fight infection) become out of control. They can divide in an abnormal way, or do not die when they should. This can lead to a range of symptoms in a patient, from rapid weight loss to fever like sweating. Many people can be fully cured of the condition through a mixture of chemotherapy, radiotherapy and bone marrow transplants - all of which point to a positive future where the concerningly high statistics in the UAE should start to drop. Heart Disease The world’s biggest killer, heart disease, is as big an issue in the UAE as you would expect - with almost 30% of deaths in the country coming as a result of it. Coronary heart disease rates are the 24th highest on the planet, and with youth obesity rates in the country rising this ranking looks destined to rise further in the near future. With the average heart disease patient being diagnosed a full 20 years earlier than the US average (at 45, rather than 65 years of age) a long battle with heart problems looks to lie ahead. Would working in the United Arab Emirates interest you? Register on our website for job alerts, and start your Odyssey today. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdqvmtavmtivmjgvmdgvmjc4lze5q2fuywrhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Dental Care Boost for Canadian Seniors

Senior citizens on low incomes will have free access to dental care in Ontario, Canada, it’s been revealed. The move is set to be included in the state’s budget for 2019, after figures showed more than 60,000 people were visiting emergency departments each year with dental conditions - many of whom were over the age of 65. Under the proposals, those over 65 who make less than $19,300 individually (or $32,000 as a couple) annually will be eligible, with hopes high that it will help to reduce some of the burden of developed dental issues on the healthcare sector. It is believed that the service would be accessed via public health units, community health centres, and health access centres - with mobile dental clinics likely to be implemented in the future. The total cost of the programme is estimated to be around $100m. Is this a good idea for targeting dental issues before they become more serious, or will it have little impact on outcomes? Let us know via our social media channels. Would you be interested in working in Canada? Register on our website for job alerts, and start your Odyssey today. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdqvmdmvmtivntuvndkvndq3lze5tlpgzwf0dxjllmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Global Health Issues 2019: New Zealand

Health issues are always evolving, with each country and continent having its own unique set of challenges. In the latest in our exclusive new series, Global Health Issues, we’ll take a look at each country we work with, and examine what conditions are most prevalent there. In the fourth article we’ll take a look at a country where we’ve got a fantastic range of exciting opportunities, especially for psychiatrists. New Zealand. It might be on the other side of the world, but making a move there is less challenging than you might imagine. Mental Health Conditions and Suicide New Zealand is facing a major problem with increasing rates of people suffering from mental health conditions, whilst the country’s suicide rate is also continuing to rise - especially amongst men. A male in New Zealand is more than three times more likely than a female to commit suicide, with it now being one of the main causes of male deaths in the country. Suicide rates in 2018 were the highest since records began, with 668 people taking their lives over the past 12 months. The country’s indigenous Maori population are not exempt from this statistic either, with suicide being the second biggest cause of death in Maori males - a figure above diabetes and Lung Cancer. The Government is increasing mental health funding in the country, to make it easier for people to find support and to try and remove the stigma that still exists - especially amongst the Maoris. Globally however mental health conditions are on the rise, and therefore it looks as if New Zealand will be battling increasing rates for many more years to come. Lung Cancer Lung Cancer is becoming increasingly widespread in New Zealand - especially amongst female Maoris. The Maoris live lives that blend tradition with the 21st century, and as a result smoking rates amongst this group are abnormally high, especially among women with estimates suggesting as many as 40% of the country’s Maori population use tobacco. This manifests itself in a higher than average rate of Lung Cancer in the country. Smokers find themselves at an 80% higher risk of the condition than others, and this is further exemplified by the fact that Lung Cancer is the biggest single killer of Maori women in New Zealand. Ischemic Heart Disease There can be many contributing factors to cardiovascular illness; diet, weight, age, race and family history can all play a part, and this range of factors means that (unsurprisingly) it’s the biggest killer in the country. Obesity rates in New Zealand are currently higher than ever, and concerningly they are continuing to rise. Currently it’s estimated that one in every three adults in the country is obese, with this figure rising for Maoris and being even greater for Pacific Islanders. Childhood obesity rates are also on the rise, meaning that the number of deaths from heart disease looks as if it will continue to rise in the future. Alcohol Abuse New Zealand appears to be facing a problem with alcohol abuse, despite the rates of those consuming it regularly dropping from 82% in 2005 to 79% by 2012. The number of people over the age of 15 drinking alcohol to potentially dangerous levels sat at 15% when the latest statistics were published, whilst Ministry of Health figures showed that 8.4% of drinkers consumed a large amount of alcohol (more than six drinks for males or four for females on each occasion) at least once a week Excessive alcohol consumption can bring with it a range of issues, with cirrhosis of the liver, anemia, Cancer and depression all closely related to it - this makes it a massive burden on healthcare. In 2009 the cost of alcohol abuse on New Zealand’s medical sector was estimated to be around $4.9bn. Diabetes in Maori Groups Diabetes rates for most New Zealanders are lower than average, however for Maoris the life long condition is one of the biggest health challenges that they could face over the coming years. Recent governmental statistics showed that just 2.8% of New Zealand’s non-Maori population had diabetes, with this figure doubling to 5.6% amongst Maoris. Genetically they appear more susceptible to the condition, whilst their lifestyle also put them at a higher risk due to higher smoking and obesity rates, and lower levels of exercise. Further to this Maoris are less likely to reach out to healthcare professionals, making the management of diabetes even less likely to be successful in the longer term. Could you help New Zealand battle any of the major health issues facing the nation, or do you believe that your career could simply be enriched by a move to the country? Register on our website today and start your Odyssey. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdqvmdmvmtivntcvntkvmzyzl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Mixed Results in UAE Survey

The results of the United Arab Emirates’ National Health Survey have been released, with adult diabetes rates dropping, but more people than ever living with high blood pressure. More than 9,000 residents from a range of nationalities living in the Emirates took part in the study, with data then compared with figures recorded in 2010. Contrary to the expectations of many, these actually showed an improvement in the nation’s health generally, whilst public satisfaction with the healthcare system hit a record high of 96%. According to the statistics, the number of adults with diabetes in the country has dropped dramatically from 18.9% in 2010 to 11.8% this year. Likewise cholesterol rates in adults have also dropped - from 57.6% to 43.7%. Furthermore the prevalence of obesity also recorded a notable decrease - dropping just under 10% to 27.8%, although this figure still remains some way above the global average. It wasn’t all positive however, with the number of adults suffering from high blood pressure almost doubling from 14.7% in 2010, to 28.8% by 2019. A range of reasons from stress to unhealthy lifestyle choices have been given for this, with the country’s health ministry now considering passing legislation that will reduce salt and sugar levels in unhealthy foods. Speaking while presenting the results of the survey, Dr Hussain Al Rand, assistant undersecretary for Health Centres and Clinics at the Health Ministry, said: “While stress and poor lifestyle are factors that contribute to the rise in blood pressure, all other health parameter averages have gone down. “This proves that the younger generation is greatly aware of its health and more youngsters are getting their blood pressure checked and recorded. This was not a trend previously.” Whilst Abdul Rahman bin Mohamed Al Owais, Minister of Health and Prevention, added: “The outcome of this survey will help update the results of several strategic health indicators and promote programmes of national health planning and policies, in addition to achieving UAE Vision 2021 and the objectives of Sustainable Development 2030.” Would a move to the United Arab Emirates interest you? Although the job market has slowed recently, we’ve still got a few attractive openings available, with more coming soon. Register on our website today to start your Odyssey.

W1siziisijiwmtkvmdqvmdmvmtavntqvmdmvotm5lze5tlpgzwf0dxjllmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Psychiatrists - New Zealand Needs You

New Zealand is keen to attract highly skilled psychiatrists to help the country in its battle with mental illness, but what attractions are there for medical professionals (at different stages of their careers) in the country? 1 - Skills Shortage New Zealand currently has a real shortage of psychiatrists, with the country dealing with what has been christened a ‘Mental Health Epidemic’. These rising rates mean that Psychiatrists are now on New Zealand’s skills shortage list. Not only does this mean that there are plenty of job openings available, it also makes it easier to apply for a visa - assuming you have the relevant qualifications and experience - removing much of the usual stress from the visa process. Furthermore New Zealand allows people to apply for residency up to the age of 56, and this is extended further for anyone applying for a work visa. 2 - Great Education New Zealand is fantastic for training positions, with the Royal Australian and New Zealand College of Psychiatrists offering high quality, internationally recognised qualifications that are easily transferable to the United Kingdom, Canada, the Middle East and beyond. Unlike in other locations, the training is more relaxed and tailored to the needs of each individual - with many of the medics we know speaking highly of well staffed rotas, and high quality supervision. Further to this it can be completed more quickly than in the UK’s NHS, making the country ideal for ambitious young medics. 3 - Work/Life Balance Possibly the biggest factor attracting people to New Zealand is the country’s famed work/life balance. Employers place a focus on ensuring that their staff maintain a healthy balance between their professional and private lives, and this can be a very welcome change from life in the often hectic NHS. If you’re feeling overworked and undervalued in your current role, then a move to New Zealand can allow you to rediscover the spark and enjoy your career once more. 4 - Flexible As well as the country’s world renowned work/life balance, many Psychiatrists also enjoy more flexibility in when and where they work. Vacancies are available right throughout the country; whether you’re looking to spend time in a large city, smaller town or more rural location, there’s likely to be an opening for you. Likewise many psychiatrists choose to work part-time, especially those with young children, making a move ideal for someone with a family. 5 - Safety New Zealand is, on the whole, a very safe and secure the country. Reports have ranked it as one of the safest worldwide to call home, whilst a stable political climate and economy can make a move a sensible long-term option. The country’s strict border controls and low level of crime creates safer communities, greater personal freedom and peace of mind for anyone living in ‘down under’. To start your journey to New Zealand register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdmvmjcvmtqvmdqvntyvmjyzlze5twfsdgfozxdzlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Mental Health Targeted in Malta

Mental health is under the spotlight in Malta, with recent suicide statistics leading to a call for action from the country’s youth council. Figures presented to parliament last week showed that there were an average of 27 suicides between 2013 and 2017 annually in the country, a high figure given the population is under 450,000. That, along with rising rates globally, has prompted the Maltese Youth Council to act, with the group consulting over 800 young people from a range of backgrounds prior to presenting their findings. One of the most notable discoveries was that physical activity can have a positive impact on mental wellbeing, leading to calls for free or discounted access to sports facilities for young people facing mental health challenges. Further to this the group are recommending that tight security should be in place at the country’s flagship new psychiatric hospital to prevent any illicit substances from being taken in, whilst the importance of regular mental health check-ups was stressed. Perhaps their most surprising finding was that 49% of respondents to the report had never been taught about mental health when they were at school, whilst the transition from child and adolescent to adult support was also highlighted as being a ‘grave concern’. Malta is a location we’ve only recently started recruiting in, however we’re already receiving plenty of interest in the area. Would you be interested in life on the sunny Mediterranean island? If so register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdmvmjcvmtmvntkvndqvmtkzl0dsb2jhbehlywx0aelzc3vlc0noaw5hlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Global Health Issues 2019: China

Health issues are always evolving, with each country and continent having its own unique set of challenges. In the latest in our exclusive new series, Global Health Issues, we’ll take a look at each country we work with, and examine what conditions are most prevalent there. In this week’s article we’re taking a look at China, a country considered by many to be a future superpower - and one that is home to some of the most modern and advanced healthcare facilities in the world. 1 - Hypertension Hypertension has been labelled China’s secret killer, with between 35% and 70% of the adult population believed to suffer from the condition. Despite this less than a third of this group are receiving treatment, with many potentially unaware that they even have high blood pressure. A range of contributing factors have been given for this recent rise in hypertension cases (which are now related to 20% of deaths in the country) with these ranging from the simple impact of an ageing population, to rapid urbanisation, poorer than ever diets and sky-high obesity rates. Until those root causes are dealt with, it looks as if China’s battle with hypertension will continue taking lives in the country. 2 - Respiratory Conditions Given the notorious issues with air quality in China’s major cities it will come as little surprise that respiratory conditions are a major issue, with those environmental factors combining with a high smoking rate to create a toxic combination. Estimates suggest that polluted air causes in excess of 350,000 deaths every year, with China being home to some of the highest COPD, lower respiratory infection and Lung Cancer rates in the world. This makes it especially challenging for medics, who may see many patients with a range of already developed respiratory conditions - even at a relatively young age. 3 - Strokes Again linked to hypertension, smoking rates and unhealthy diets, strokes are becoming a major health issue in China. Strokes are the second most common cause of death in the country, although recent research published by the BMJ does hint that these rates may have started to drop slightly. Unhealthy diets in China peaked around 20 years ago, with the introduction of fast food, and the rejection of more traditional eating habits, however greater education looks to have had a positive impact on this trend, and so hopes are rising that it may not become as big an issue as once feared. 4 - Diabetes Few people think of China when they are researching diabetes. The Gulf, the USA and even parts of Europe are thought to have far higher rates, whilst historically it hasn’t been an issue that has affected China. That has all changed over the past 20 years however, with the country now home to the most diabetics in the world - a statistic that represents an incredible rise since the 1980s when just 1% of the population had the condition. 13% of the country’s total health expenditure now goes towards the treatment of diabetics, and this rate only looks as if it will rise in the future as the health of the nation continues to decline. 5 - Childhood Obesity One in five Chinese children are now obese despite the country’s adult obesity rate being among the world’s lowest. According to a recently released study, a vast range of factors linked with China’s development have been given for this dramatic rise - with one of the more unique reasons actually placing the blame on the children’s grandparents! Many grandparent age Chinese still see being overweight as a positive, with this group having lived during periods of extreme poverty where little food was available. As a result studies have shown that they now overfeed their grandchildren. That is far from the only reason for the shocking increase however, with rapid development, growing personal wealth levels, the rise of junk food establishments and increasingly sedentary lifestyles all playing a major role in creating a environment where obesity can thrive. Would you be interested in a move to China? It can offer a real career boost and allow you to test your skills in a fast-paced and challenging environment. Register on our website today to find out more - a dream move could be closer than you might imagine.

W1siziisijiwmtkvmdmvmjcvmtqvmdivmzyvnji4lze5tlpozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Kiwis Need Access to Dental Care

New Zealand’s medical association has called for all Kiwis to be given access to ‘comprehensive and affordable dental care’. Currently only children in the country are eligible for free dental care, and with treatment costs potentially rising into the thousands of dollars that leaves many New Zealanders living with daily chronic pain. It is hospitals who are seeing the biggest impact of this, with many reporting a sharp rise in the number of patients attending emergency departments for tooth extractions and other dental issues. Chairwoman of the NZ Medical Association, Dr Kate Baddock, highlighted just how serious she believes the issue is becoming. She said: “Dental decay remains the most prevalent chronic, yet reversible, disease in New Zealand. “While children have access to free dental care this is an issue for all age groups including older New Zealanders, and cost is a major barrier. “Maori and Pasifika groups have worse oral health outcomes as well as those living in areas of higher socio-economic deprivation, and this equity issue must be addressed.” Tackling the issue will come at a sizeable cost however, with almost $200m already spent annually on oral health care for young people in the country. As a result Health Minister David Clark has revealed that, despite the huge issues, little will be done before the 2020 election to target New Zealand’s serious problems. Could your skills help New Zealand as the country battles with dental issues? Register on our website today for job alerts - a dream move could be closer than you might imagine.

W1siziisijiwmtkvmdmvmjavmtmvmjkvndivndi0l0dsb2jhbehlywx0aelzc3vlc0t1d2fpdc5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Global Health Issues 2019: Kuwait

Health issues are always evolving, with each country and continent having its own unique set of challenges. In the latest in our exclusive new series, Global Health Issues, we’ll take a look at each country we work with, and examine what conditions are most prevalent there. In the second installment we’ll take a look at Kuwait. Once a booming expat destination, many now overlook it in favour of neighbours like Saudi Arabia, the UAE and Bahrain, however a small number of expats do still take the jump each year. Bronchitis & Lower Respiratory Problems The prevalence of conditions such as COPD and lung abscesses appears to be on the rise in Kuwait, although strict bans on smoking in public places are covering more and more of the country, with the aim of reducing this statistic in the future. According to the latest figures it was estimated that over 4,000 people lost their life as a direct result of a respiratory condition, a rise of over 100 annually. A range of reasons have been given for these issues. Smoking rates in the country are still higher than they are in most Western locations, whilst the amount of cars and oil refineries in the major industrial areas creates an unhealthy environment. Further to this year round dust from the desert, along with constant building work, have also been put forward as factors behind these worryingly high statistics. Diabetes Given Kuwait’s well publicised issues with lifestyle related health conditions, it should come as little surprise that Diabetes rates in the country are amongst the highest in the world - with an estimated 37% of the population suffering from the condition - almost double the global average. Concerningly the number of children with type-1 Diabetes is also at a world leading level, meaning that it looks as if the country will have to work with patients suffering from the condition for many years to come. People with Diabetes find themselves at a higher risk of a range of health issues, from eyesight disorders to heart conditions and kidney failure. Heart Disease and Strokes Completing a hat-trick of lifestyle related health conditions is the number of people suffering from heart disease and strokes in Kuwait. As with most Gulf locations Ischaemic heart disease is the biggest single killer of residents in the country and, when combined with strokes, it leads to the deaths of over 1,500 people every year. Unhealthy diets remain widespread and a lack of physical activity has lead to Kuwait being branded the ‘fattest nation on earth’ with a staggering 42.8% of the population classified as being obese. Until that figure drops it looks as if Kuwait will continue to face the same serious health issues. Womb Cancer Worldwide Cancer remains one of the most feared, and most common, illnesses. In Kuwait this is no different, with Womb Cancer rates being the ninth highest on the planet. The condition can affect women of any age, bust most commonly it is seen in those over 50. It’s not yet known what causes it, however it is thought to be closely linked to hormone imbalances, diabetes and obesity - which may explain its prevalence in the country. Road Accident Injuries Moving to Kuwait? We’d recommend getting a driver, the highways can be wild. Although not a health issue in its own right we felt it right to include road accidents in this feature. Kuwait’s roads are some of the most dangerous in the world, with almost 700 people dying on them each year. Driving standards are poor, with the use of smartphones and cigarettes behind the wheel given as the major reasons for the terrifying statistics. Injuries sustained in accidents can range from minor strains, fractures and breaks to severe (and potentially debilitating) head, neck and back injuries. This makes trauma surgeons especially in demand in the country. Would you be interested in a move to Kuwait? Opportunities don’t come along very often, so register on our website to get ahead of the rest today.

W1siziisijiwmtkvmdmvmjavmtmvndmvndavmjgzl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

UAE Tops Wellness Report

Reading time: Two minutes The United Arab Emirates is the best country in the world for access to quality healthcare, whilst it is in the top ten for overall well-being according to a new report. Data compiled by American analytics giant Gallup saw the Emirates ranked as one of the best locations globally to call home, with it posting world leading figures in five of the categories studied. As well as access to high quality healthcare, an indicator that pays tribute to the hard work of those working in the sector and the high levels of Government investment dedicated to it, the UAE also lead the world in how safe residents felt, their satisfaction with Government policy to protect the environment, the country’s employment ratio and the number of people with access to a mobile phone. Covering 160 locations, and looking at factors that make people healthy, comfortable or happy, the Emirates also received a notable second place finish for absence of health problems - despite rising obesity rates. A result that further works to highlight the good work of those in the medical sector. On top of this it was ranked as the fifth best location globally for children, making a move ideal for those with a young family. Speaking about the findings, Minister for Happiness and Wellness, Ohoud bint Khalfan Al Roumi, said: “The UAE's advanced ranking on the indicators reflects the country's focus on enhancing wellbeing in all sectors. “I must praise the efforts of all government, private, community and academic organisations in the UAE as being the driving force behind this achievement, which reflects the vision and direction of the UAE’s leadership.” Would a move to the Emirates be something which would interest you? Register on our website to start your Odyssey today.

W1siziisijiwmtkvmdmvmjavmtmvmzqvmzqvntq5lze5q2hpbmfozxdzicgxks5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

1 in 5 Chinese Children Now Obese

Reading time: Two minutes One in five Chinese children are now obese according to a new report, despite the country’s adult obesity rate being among the world’s lowest. According to the study, published last week by a research team at Peking University, a vast range of factors linked with China’s development have been given for this dramatic rise, with one of the more unique reasons actually placing the blame on the children’s grandparents! Many grandparent age Chinese still see being overweight as a positive, with this group having lived during periods of extreme poverty where little food was available. As a result studies have shown that they now overfeed children - especially during early stages of their life. That is far from the only reason for the shocking increase however, with rapid development, growing personal wealth levels, the rise of junk food establishments and increasingly sedentary lifestyles all playing a major role in creating a environment where obesity can thrive. In an attempt to prevent rates from rising further the new report’s co-author Jun Ma said: “This suggests a pressing need for policy responses that may include the taxation of food and beverage with added sugars and fats, subsidies to promote dietary diversity, and strategies to promote physical activity and health education.” Could you help China in its battle with obesity and the related health conditions? Register on our website today to start your journey - a dream move could be closer than you might imagine.

W1siziisijiwmtkvmdmvmtqvmtavmzavmtgvmty4lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Calls for Australia to Legalise Nicotine E-Cigs

Australia should legalise electronic cigarettes with nicotine if the country is serious about improving its health according to a leading academic. Professor Tony Blakely from the University of Melbourne made the claims as he cited the serious impact of tobacco smoking on the health of the nation, and on the country’s healthcare sector. Unlike in the United Kingdom, New Zealand or United States, electronic cigarettes featuring nicotine are only available with a prescription in Australia, and professor Blakely believes that this could be having a negative impact on the country’s population. Studying data from New Zealand, a range of positive outcomes have been identified following the country’s decision to legalise nicotine e-lites, with these no solely linked to the health of individual. According to figures, legalising the devices gained Kiwis around 236,000 quality adjusted life years, with this saving the healthcare system in the country an estimated $815 per person - money that could then be spent on other areas. Despite the positives however Professor Blakely acknowledges accepts that nicotine based electronic cigarettes can be seen as more attractive to young people - however pointed to a joint US/UK report which showed little impact on youth smoking rates when they were introduced. Electronic cigarettes are hugely controversial, with many medics split on their effectiveness. Should they be promoted as an alternative to tobacco, or do they simply transfer the problem? Let us know your views via our social media channels.

W1siziisijiwmtkvmdmvmtqvmtmvmdyvmtavnde1l0dsb2jhbehlywx0aelzc3vlcyaomskucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Global Health Issues 2019: Canada

The biggest health issues are always evolving, with each country and continent having its own challenges. In the first of a new series, Global Health Issues, we’ll take a look at each country we work with, and examine what conditions are most prevalent there. In the first installment we’ll take a look at Canada, a vast country that faces some equally as big challenges. Cardiovascular Disease Cardiovascular disease remains one of the world’s biggest killers, and so it’s little surprise to learn that it remains a huge issue in Canada. Many cases can be brought on by unhealthy lifestyle choices like a poor diet, little exercise and smoking tobacco. Although tobacco consumption rates have dropped in recent years, obesity rates appear to be on the rise - potentially resulting in a great number of cardiovascular issues. According to statistics poorer people are at a 49% greater chance of cardiovascular conditions, with more than 1.6m people now battling heart issues in the country - a figure that has actually dropped slightly since the 1960s. Cancer As with cardiovascular disease, cancer is an issue throughout the world - one which medical researchers have spent a long time studying, with only a small amount of success recorded to date. In Canada Lung, Colorectal, Prostate and Breast Cancer are the most common types of the condition, with more than 200,000 cases diagnosed annually. Current research suggests that around half of all Canadians will get Cancer during their lifetime, with a quarter losing their life as a direct result. This has lead to calls for a more proactive response, focused on the benefits of early screening and ensuring that you avoid any risk factors. Opioid Abuse Aside from some of the larger global issues, Canada also has problems with addiction - especially to opioids. Painkiller addiction is one of the largest issues in the country, with more than 9,000 deaths recorded over the last 16 months as a direct result of individuals overdosing on medication. This has lead to a 73% rise in hospital admissions for opioid poisoning in one state alone. A stigma has started to build up around their use, with the issue potentially growing at a far greater rate than any statistics can show, due to the underground nature of the addiction. Mood Disorders Over 2.6 million people in Canada currently suffer from mood disorders, with this most prominent amongst working age people in the country. Issues related to anxiety and bipolar disorder are the most common, with many cases brought on by an unhealthy work/life balance. It is estimated that, by the age of 40, 50% of Canadians will have experienced at least one mental health issue in their life - with rates amongst young people especially soaring. Whilst still not quite at the stage of New Zealand and Australia, mental illness remains a huge issue in Canada - and with awareness and stigma starting to drop, it looks set to require greater help in years to come. Diabetes Given the increasing rates of obesity and cardiovascular disease, it should come as little surprise that diabetes levels are also on the increase in Canada. Currently more than 3 million people live with the condition, and around 200,000 new cases are being diagnosed annually. As with cardiovascular conditions, wealth can have an impact of your risk factor - with those who are less well off 51% more likely than the wealthiest group in society to have issues with the condition. Campaigns raising awareness around how to avoid type-two diabetes are being rolled out throughout the country, however in many cases it’s already too late. Would a move to Canada interest you? Could you help the country in its battle with any of the conditions outlined above? Register on our website today to start your Odyssey, a dream move could be closer than you might imagine.

W1siziisijiwmtkvmdmvmtmvmtqvndyvmjyvndgwlze5r2xvymfstmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

'Tsunami' of Cancer Cases Expected in Gulf

The Middle East needs a more sustainable strategy for Cancer support, with a possible ‘tsunami of cases’ on the horizon experts have warned. Speaking at the ‘War on Cancer Middle East’ conference in Dubai, healthcare leaders, policymakers and researchers focused on rising rates in the Gulf region, and how these can be strategically dealt with across public and private sectors whilst utilising both preventative and longer term care techniques. Cancer rates have grown staggeringly over the past decade in the Gulf - with rates in the UAE rising by 62%, and those in Saudi Arabia increasing by 49%. These figures may not be as daunting as they initially seem however, with greater awareness of screening and diagnosis at an early stage becoming widespread during this period. The Middle East’s issues with lifestyle related health conditions have again been highlighted as a reason why Cancer is likely to become a huge problem, with around a third of Cancer related deaths linked to lifestyle factors. Dubai is the location that looks set to face the biggest challenges, as Dr Younus Mohammad Ameen Kazem, Dubai Healthcare Corporation CEO, explained: “Dubai is emerging as a population hub within the UAE, with 29% of the country’s population now living there. This share is expected to increase in future due to economic growth, and greater insurance penetration. “The emirate is witnessing a growing burden of morbidity and mortality related to oncology. Oncology care in Dubai is available, but currently fragmented. We are working to enhance current cancer care to offer a world class internationally recognised service to Emiratis, expatriates and foreign health care tourists.” In line with United Nations development goals, the Emirates is aiming to reduce premature deaths from non-communicable diseases by 30% by 2030, with Cleveland Clinic Abu Dhabi’s Chief Medical Officer, Dr Madhu Sasidhar, keen to implement a new approach. He said: “We generally take a top down approach to cancer prevention, but it should begin in schools with education for children on how they can protect themselves from cancer with certain lifestyle choices. “Obesity, lack of exercise and smoking increase the risk of cancer, and children need to be aware of that.” Could you help the Middle East as it battles growing Cancer rates? We’ve got positions on offer in the UAE, Saudi Arabia and Oman on our website - simply visit the jobs section to find out more.

W1siziisijiwmtkvmdmvmdyvmtmvmjkvmtavoduwl09kexnzzxlhdwlkzvjpewfkac5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

The Odyssey Guide to Riyadh

We’ve already taken a look at expat life in Jeddah and so, in the final part in our Odyssey Guides series, we’re going to take a look at another popular Saudi location - Riyadh. Located in the heart of the Kingdom, and home to more than five million people, Riyadh is one of the Middle East’s biggest hubs for business and finance, however it is also more conservative than the relaxed coastal areas of Jeddah in the west or Jubail in the east. This means that it’s vital to do your research before committing to a move. Where to live? Given the size of the city, and how hectic the traffic can be during busy periods, we’d recommend choosing accommodation that’s near your place of work - a lengthy commute in a country with questionable driving standards isn’t how anyone wants to start their day. In terms of popularity and desirability however, there are plenty of good options - almost all of which are based in secure compounds. Al Muhammadiyah is arguably the most sought after district in the city, offering fantastic facilities and top class accommodation that means it isn’t necessary to leave the compound itself too often whilst you settle in. This comes at a cost however, and so many expats (especially those with families) chose to make their money go further by staying in compounds around Al Nakheel, where the spacious villas often come with decent sized gardens. What is there to do? The National Museum - Saudi Arabia is home to a rich culture and history, and Riaydh’s national museum can be a great way to discover more about the Kingdom. Wadi Hanifa - Think of Saudi Arabia and you probably think of arid desert, not the scenic Wadi Hanifa valley that runs through areas of Riyadh. It’s perfect for leisurely walks. Al Watan Park - Looking for a way to entertain young children? Al Watan Park can be perfect, with the family friendly little theme park the ideal place to spend weekends. Where am I likely to be working? Saudi Arabia is home to a strong public and private healthcare sector, however there are also plenty of smaller medical centres that we’d recommend avoiding. There is a relatively even split between medics moving to work in the private sector, and those moving to work in the public facilities, with both offering high quality care within a modern environment. We only work with the larger private healthcare providers, and so any jobs posted on our website will adhere to strict quality standards - with most facilities being accredited by the Joint Commision International. Who is suited to a move? A move to Saudi Arabia can feel like a daunting prospect and, despite the obvious financial benefits, choosing to live in Riyadh is certainly not for everybody. Ideally we’d recommend it to an experienced medic keen to maximise their earning potential, whilst testing their skills in a challenging environment. Medics, and especially those with Western qualifications, will be expected to work independently in the country - with a strong focus placed on them to make decisions based on prior experience. As a result a move isn’t great as a first step overseas for a newly trained medic, nor would it suit someone with little experience of other cultures. If you’ve got the experience however, and a passion to learn more about a fascinating part of the world, then spending a few years in the Desert Kingdom can be an extremely attractive prospect. Why move? 1 - Few locations on earth can offer salaries as high as Saudi Arabia, and a cost of living as low. Riyadh might be one of the more expensive locations in the country, but prices are still well below cities like Dubai or Doha. 2 - You’ll be given more responsibility within the hospital, thus having more freedom to tackle cases in the way you believe best. 3 - Saudi’s rich culture can make a move fascinating and immersive. 4 - Most of the compounds can offer a high standard of living, and plenty of opportunities to meet fellow expats. 5 - Riyadh is home to some high quality international schools, teaching a range of curriculums.

W1siziisijiwmtkvmdmvmdyvmtmvmzmvmjqvmtg2lze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Dammam Hospital to Open Soon

Saudi German Hospital’s flagship new centre in Saudi Arabia’s Eastern Province should open in June bosses have confirmed. Located in Dammam, near the coastal town of Al Khobar and the King Fahd Causeway to Bahrain, the new facility is now said to be two-thirds complete. Covering almost 40,000 square meters, the hospital will boast a capacity of up to 300 beds and 100 clinics, with eight operating theatres - making it one of the largest in the Eastern Province. The facility will become the fifth Saudi German Hospital in the Kingdom, with the group already operating centres in Jeddah, Riyadh, Medina and Khamis Mushait, with Sobhi Batterjee, President of the Group, optimistic about the impact their growing portfolio could have on healthcare in the region. He said: “This is an important milestone for SGH Group as we continue to expand in the region to increase patient access to world-class healthcare. “The Saudi German Hospital in Dammam is a testament to our group’s commitment to ensure that our patients across Saudi Arabia receive best in class healthcare service and expertise. “It also reflects our ambition to continue investing and expanding across Saudi Arabia in addition to other markets from the MENA region, and the world, to improve the health and well-being of communities across the globe.” Is working in Saudi Arabia something which would interest you? If so register on our website and start your journey today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdmvmdyvmtmvmjyvmzqvmzq4lze5twfsdgfozxdzlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Dental Services Needed in Malta

People in Gozo, Malta’s largest secondary island, are in need of better dental services, with recently published research studying 332 patients at a mobile clinic on the island. The findings, which were compiled by the University of Malta’s medical school, showed that 78% of patients required restorative treatment in their gums, whilst two-thirds of those over the age of 20 were missing teeth. Taking a more general look at oral health in the nation, the researchers found that children’s dental health in Malta is fast deteriorating - with a notable rise in tooth erosion noted especially in pre and primary school children. Much of the blame for this has been placed on carbonated and sugary soft drinks which are often targeted at this market. Speaking about their findings, a spokesperson for the research team said: “The findings highlight the need for provision of better dental services in Gozo, re-orientation of existing services to focus on prevention, and the introduction of evidence-based preventive strategies in schoolchildren. “The idea is to change the environment surrounding people making it conducive to the awareness surrounding the importance of oral hygiene. Improvements in economic and educational status, accompanied by policies that promote oral health, all bring about long-term improvements in health in general.” Gozo and Malta are fast becoming hugely attractive with medics seeking a more rewarding career overseas. Could you help the country in its battle with dental issues, or could your skills enhance healthcare in other areas? Register on our website to start your Odyssey today.

W1siziisijiwmtkvmdivmjcvmtqvmdqvmtevntawlze5q2hpbmfozxdzicgxks5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Chinese Research Links Stress & Cancer

Researchers at Dalian University in China have revealed that chronic long-term stress can lead to a growth in Cancerous cells. The results, published last week in the Journal of Clinical Investigation, highlight the impact of Epinephrine - a hormone produced during periods of extensive stress. According to their findings experiencing constant, long-term, feelings of stress leads to epinephrine bonding with ADRB2 in a reaction which boosts levels of the enzyme lactate dehydrogenase. Whilst this can provide an energy boost during a tough time for an individual, a byproduct of it is an organic compound - lactate, which cancer cells feed off to provide them with an energy boost to feed on and grow. After this intriguing discovery, researchers then altered their focus towards combating the impact of epinephrine, with vitamin-C surprisingly shown to reduce tumour growth, albeit the effectiveness can only be assessed after extensive further research. China is fast becoming a hub for advanced medical care and research, making it extremely attractive to medics looking to test their skills in a challenging and fast-paced environment. Is it somewhere that would interest you? Register on our website today for the latest job alerts - a dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdivmjcvmtqvmdkvmdkvmzixlze5r2xvymfstmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Gulf Health Continuing to Drop

Reading time: 3 minutes An increasingly unhealthy lifestyle has seen Gulf nations fall in Bloomberg’s 2019 healthiest country index, with Spain becoming the surprise leader. The study, which examines a range of factors from life expectancy to obesity and exercise rates, saw Bahrain named as the only Gulf location where the nations’ health improved - with The UAE (-3), Kuwait (-22) and Saudi Arabia (-6) all recording sharp falls. At the other end of the table six European nations were joined by Japan (4th), Australia (7th), Singapore (8th) and Israel (10th). Elsewhere Canada ranked 16th - 19 positions above the United States - whilst Malta’s high quality healthcare, and Mediterranean diet saw it ranked 27th. In the Far East China continued to improve, rising three places to 51st - with healthier lifestyles, and a greater awareness of lifestyle related health issues starting to have an impact. Despite positivity in the Far East however, the Gulf’s continual battle with unhealthy lifestyles remains a massive concern to those in the region, which is home to some of the world’s highest rates of diabetes and obesity. Given the issues caused by lifestyle related health, the region’s lack of preventative care was also heavily criticised. Research appears to be the main way in which the Emirates is responding to these challenges, with a long-term study focusing on the causes of heart disease and diabetes in more than 20,000 Emiratis currently being worked on by one of the country’s leading Universities - with factors beyond lifestyle such as environment and genetics being a key focus. Dr Raghib Ali, of the New York University Abu Dhabi, explained why he believes a focus now needs to be placed on an individual to take responsibility for their health. He told ‘The National’: “Although there’s excellent healthcare cover and state of the art facilities in terms of screening programmes for things like diabetes and heart disease, there needs to be more emphasis on that and also on programmes around smoking and improving physical activity.” What is the key to the Gulf sorting its health problem? Let us know you views via our social media channels.

W1siziisijiwmtkvmdivmjcvmtqvmdavmjqvmtq1l09kexnzzxlhdwlkzvn0snmucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

The Odyssey Guide to St John's

To many people a move to Canada means Toronto, Vancouver or Montreal, however most expats will likely have their first job in a more remote location - and St John’s, in stunning Newfoundland and Labrador, is the most sought after of these cities. Although geographically fairly remote, the city has charm in abundance, and the friendly locals and safe streets make it a brilliant place to call home. It certainly won’t suit everyone however, so read on to discover more about one of Canada’s most fascinating cities. Where to live? Unlike the vast modern metropolises we’ve previously covered in this series, St John’s is a small, charming little city that isn’t dominated by enormous skyscrapers and a hectic pace of life. There are plenty of residential options for people looking to make the move, from larger townhouses and family homes, to character apartments in the heart of the vibrant and colourful city centre. What is there to do? Signal Hill - Overlooking the city, Signal Hill was previously a strategic armed forces location, however now it allows for stunning walks with views over St John’s and beyond. The Rooms - A modern art gallery that hosts a range of art dedicated to natural and local history. George Street - Known throughout the city as one of the best locations for a night out, George Street is home to some excellent bars and restaurants. Where am I likely to be working? If you move to St John’s then you’ll be working in the city itself. The small size means that it is home to just a small number of hospitals and most of these are based around the Downtown area - near the harbour. Traffic isn’t a major issue, even at peak times, and Canada’s excellent road network makes commuting into the city centre relatively easy. Who is suited to a move? We think that a move to Canada is great for a younger medic looking for a long-term or permanent relocation, and St John’s is no exception. The quaint little city can be a great place to start your Canadian adventure, with a high-quality, supportive working environment and a relaxed, friendly atmosphere. Combine this with great schools and it starts to look ideal for those with a family. If financial growth is your main reason for seeking a move however we’d suggest looking elsewhere. Wages in Canada is reasonable, but the cost of living can be higher than average - and tax is paid, unlike in the Gulf. Why move? 1 - The local economy is now stronger than ever. 2 - St John’s is home to some fantastic educational facilities for expats with families. 3 - The city is a cultural hotspot, and home to a thriving creative scene. 4 - For someone looking to avoid a hyper-developed modern city, St John’s glorious scenery can be perfect. 5 - As you would expect from Canada the hospitals are ran to an extremely high standard, with medics offered plenty of support when needed.

W1siziisijiwmtkvmdivmjavmtqvndevndevotc1l09kexnzzxlhdwlkzufiduroywjplnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to Abu Dhabi

Reading Time: 3 Minutes Abu Dhabi is one of the United Arab Emirates’ most popular locations. The country’s capital is the main cultural and financial hub of the Emirates, but remains less of a hyper-developed metropolis than Dubai. That makes it extremely appealing to expats looking for a less artificial location experience, but with all the benefits and attractions of the United Arab Emirates. Where to live? Abu Dhabi is home to plenty of popular locations with expats and locals alike, with the general standard of accommodation as high as you’d expect from a city with as prestigious an image. The more suburban areas of Al Karamah and Al Rowdah are popular amongst expats with families. Close to some of the top international schools, and with great transport links to the malls, but without the hectic atmosphere of the city centre, it should little surprise that these areas are so popular with professionals looking to relax at home. If you’re keen to be based closer to the centre of the city, then Downtown Abu Dhabi is a highly sought after and popular location. Space can be at a premium here, but the lively atmosphere and array of high quality restaurants and attractions can make it extremely appealing. What is there to do? Sheikh Zayed Grand Mosque - You couldn’t spend time in Abu Dhabi without visiting the incredible Grand Mosque, an intricately designed building and one of the biggest mosques in the world. Yas Island - A recently developed island, and home to plenty of high quality restaurants, shops and entertainment facilities. The island also hosts Abu Dhabi’s F1 Grand-Prix. Louvre Abu Dhabi - Only officially opened in late 2017, Abu Dhabi’s Louvre aims to bridge the gap between Eastern and Western art. Where am I likely to be working? Abu Dhabi is home to a range of high quality, modern hospitals, with most expats finding roles in the private sector. Burjeel Hospital is one of the most highly regarded, however it is far from alone in the standard of care on offer, with large companies like NMC and Cleveland Clinic also running facilities. There are hospitals throughout the Emirate, however the area around Al-Bateen and Al-Eithad is especially popular. Who is suited to a move? Abu Dhabi can be an expensive place to call home, and it remains slightly more traditional than the expat hub of Dubai. Whilst this allows people moving there a more authentic Arab experience, it won’t suit everyone - especially younger medics, or those seeking a move with little culture. When combined with the relatively independent working environment we believe that Abu Dhabi is best suited to an experienced medic looking to take a break from the monotony of life at home. Expats moving to Abu Dhabi normally stay for between two and five years, with it being increasingly unusual for someone to set-up long-term roots in the Emirate. If you’re looking to experience a new culture, test yourself in a new environment, and live in one of the world’s most impressive cities, but don’t want to leave your home location permanently, then few locations can be better. Why move? 1 - Abu Dhabi is a rich cultural melting pot, where you can meet people from all over the world. 2 - As the UAE aims to move on from an oil-centric economy healthcare is receiving generous investment. 3 - Abu Dhabi is becoming a growing hub for cultural activities in the Gulf, with many concerts, productions and art exhibitions visiting the Emirate. 4 - The cost of living might be high, but few locations on the planet can offer such a luxurious lifestyle. 5 - There’s always lots going on in and around the Emirate, meaning that you shouldn’t ever run out of things to see and do! Interested in moving to Abu Dhabi? Register on our website today for job alerts, and all the latest healthcare news from the area.

W1siziisijiwmtkvmdivmjavmtqvnduvndqvoduyl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

UAE Legalises Vaping

Reading Time: 2 minutes Electronic vaping products are to be legalised in the United Arab Emirates from mid-April, prompting further debate about their effectiveness. Whilst e-cigarettes have been shown to be less harmful than tobacco, doubts still remain over how much more effective they actually are, whilst concerns about the healthier image of e-lites might lead to a rise in the number using them it’s been warned. Government officials who have been discussing whether or not to legalise the devices, have revealed that a growth in the unregulated market prompted them to act, with strict regulations ensuring that they come with health warnings and meet strict safety standards. Globally the e-cigarette market is growing at a rate of around 20% annually, with many proponents arguing that it can be a great way to help people quit smoking tobacco. Despite this however many other groups have been vocal in their opposition to ‘vaping’ products, with different flavours making them particularly appealing to younger people. This was especially a worry for Dr Hassan Mohamed Aref Shabana, consultant respiratory physician at Zulekha Hospital, Sharjah, who told ‘The National’: “In countries where vaping is allowed, school age pupils who were never smokers before have taken up vaping. “This increases the number of those with nicotine addiction at a young age, who will possibly shift towards regular cigarettes later in life. “Vaping may increase nicotine dependence and addiction as it does not have a lasting smell. It can be used in cars, offices, planes and trains, without the smell or social stigma. “As well as that the long-term health damage may only be seen after many years of use.” Is the UAE right to legalise the selling of electronic cigarettes, or should more be done to eradicate smoking completely? Let us know via our social media channels.

W1siziisijiwmtkvmdivmjavmtqvndgvmjevnzc5lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Cervical Cancer to be Wiped Out in Australia

Reading Time: One minute Cervical cancer could be eliminated globally by the end of the century, with Australia on target to be the first nation to eradicate the condition completely. Australia has long been lauded for a high take up of the HPV vaccine, with research published in the Lancet Journal showing that increasing the availability of screening and vaccines should reduce rates to around four per 100,000 women globally by 2100. The HPV virus is responsible for more than 90% of cervical cancer cases, with estimates suggesting that 99.8% of cases in the UK are preventable - highlighting just how important it is to be vaccinated. That has given Professor Karen Canfell, member of the research team at Cancer Council NSW who led the study, hope that elimination should be possible in the not too distant future. She said: “Despite the enormity of the problem, our findings suggest that global elimination is within reach with tools that are already available, provided that both high coverage of HPV vaccination and cervical screening can be achieved.” Can cervical cancer be wiped out within a generation, and how big an achievement would this be? Let us know your views on our social media channels. Interested in moving to Australia? We’ve got a range of exciting opportunities available, simply register on our website to start your journey today.

W1siziisijiwmtkvmdivmtmvmtmvntuvndgvotiwl09tyw5ozxdzlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Oman Healthcare Roundup

Reading time: 2 minutes New Hospital for Dhofar Oman’s Ministry of Health is set to officially open a new £2.4m hospital in the Dhofar Governorate. Funded by Petroleum Development Oman, ‘Shaleem Hospital’ will host an outpatient clinic, emergency unit, radiology department and medical laboratory - despite having just 14 beds. Dhofar, to the south of the country around 1,000km from Muscat, is the largest Governorate in the Sultanate by area - but is home to just 460,000 people, 340,000 of whom reside in the state capital Salalah. Rural Health Targeted A voluntary initiative bringing basic healthcare to some of Oman’s most rural communities has been launched. Eblal (or healing) aims to educate those living in the mountainous regions of the Sultanate on basic first-aid skills, and how to manage common long-term issues like high blood pressure and diabetes. Staffed mainly by teams of medical students, the groups have travelled to areas where the nearest hospitals are more than 50km away - with residents often having little access to transport. As well as initial visits, follow up trips are also planned to help guide villagers onto the right path when working to manage health issues, with hopes high that greater education will lead to better health outcomes for those living outwith the major cities. Work Starts on Dialysis Centre Muscat will soon have a new dialysis centre, with construction underway on a £2m development in the Al-Amarat area of the province. Funded by the heirs of Abdullah bin Moosa Al-Raisi, the new centre will be home to 37 beds (ten of which will be reserved for isolation) and cover more than 1,500 square metres. Diabetes, the number one cause of chronic kidney disease, is becoming a major issue in Oman, with the Sultanate now home to an estimated 80,000 people battling the condition. That makes it all the more vital that more facilities are opened to help cope with the rapidly growing demand. Would you be interested in working in the unique and beautiful Sultanate of Oman? We’ve got a few attractive openings available on our website, register today to start your journey.

W1siziisijiwmtkvmdivmtmvmtmvntivmdqvmtmxlze5tlpozxdzlmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Childhood Obesity Targeted in NZ

Read time: 1 minute Leaked papers have revealed ambitious plans that aim to have half of children walking or cycling to school in New Zealand by 2030. The country is home to one of the developed world’s highest childhood obesity rates, with the Ministry of Health now keen to stop this alarming trend by promoting everyday physical activity. Documents produced by Government officials have revealed aims to have 60% of schoolchildren attending classes via ‘active transport’ by 2030, whilst an action plan is also to be introduced aimed at increasing exercise participation rates generally over the next 11 years. As with many other locations globally, regular physical exercise rates have dropped slightly among adults in New Zealand, whilst the number of people who are physically inactive has risen to almost 15% of the total population. This comes at a massive cost, with estimates suggesting that the cost of inactivity to the nation is over NZ$1.3bn. Could promoting active travel be the key to getting more young people active, or do bigger steps need to be taken? Let us know your views via our social media channels.

W1siziisijiwmtkvmdivmtmvmtmvndgvndmvoti4l09kexnzzxlhdwlkzu11c2nhdc5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

The Odyssey Guide to Muscat

Reading Time: 3 minutes Oman is often referred to as the Gulf’s hidden gem. The unique Sultanate offers a tremendous mix of traditional Arab culture and architecture, and more modern liberal values and beliefs than many of its neighbours. Considered to be one of the friendliest locations in the region, it’s somewhat of a surprise that it is often overlooked by many considering a move to the area. Especially given the high quality healthcare facilities (and impressive salary packages) on offer in and around the capital city, Muscat. Where to live? Madinat Al Sultan Qaboos is one of the most sought after locations in the city, offering luxurious villas with gardens that are ideal for families. There are plenty of modern apartments for smaller groups too, and the district is just a kilometer away from golden beaches and a cooling breeze. If you’re looking for a seriously luxurious standard of living then Shati Al Qurm is the best option. Located near the Royal Muscat Opera House, accommodation comes at a cost, but to many who find a dream home there, it’s one worth paying. For a medic looking to maximise their earnings, the area of Ruwi in the heart of the city could be an attractive option. Prices are lower here, but the quality of accommodation can vary dramatically - making it vital that you view a property before committing to a rental agreement. What is there to do? Royal Opera House - Opened in 2011, but built in a stunning classical style, it is Oman’s premier arts venue. National Museum of Oman - Keen to discover more about the Sultanate? Oman’s national museum, located in Old Muscat, provides a fascinating glimpse into the city’s past. Al Riyam Park and Corniche - The perfect place from which to appreciate Muscat’s unique charm, you can take a stroll as the sun sets over the harbour. Where am I likely to be working? Most hospitals in Muscat are located in the north, or north-east of the city, however as a large area it can take almost an hour to travel from one side of the city to the other. The large high-quality hospitals are often located near the popular expat areas and international schools, however we’d always recommend that you know your commute before signing a rental contract. Traffic might be more manageable than in the UAE at peak times, however the roads can still be hectic. Who is suited to a move? We think a move is ideal for experienced medics taking their first steps into the Gulf region. Oman’s friendly atmosphere and relatively liberal laws make it an easier introduction to the Middle East for expats, whilst experience is vital when working in a department with few other Western trained physicians. People with young families will also appreciate the lifestyle and safety, however those with slightly older children may find themselves struggling for things to do. We also wouldn’t recommend Oman to those with little experience, as a lot of independent working and problem solving can be required. Whoever you are however one thing is for certain, you’ll be warmly welcomed into the Omani way of life. Why move? 1 - The city still has a rich identity that hasn’t been eroded by new developments and high-rise buildings. 2 - Tax free salary packages can make a move extremely rewarding financially. 3 - There are a range of outstanding international schools. 4 - Oman is home to plenty of untainted natural beauty. 5 - By Gulf standards the Sultanate is relatively liberal, certainly far more so than Saudi Arabia, Kuwait and even the UAE. Would you be interested in a move to Oman? Register on our website today to start your journey, a dream move could be closer than you might imagine.

W1siziisijiwmtkvmdivmdyvmtmvndgvndivotk3l1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Boost for UAE Donors

Organ donation in the UAE is being made easier thanks to integration with smart technology and residents’ Emirates ID cards. Due to be launched later this year, the new smart health card will contain basic medical information about residents, including their blood type, allergies and any chronic disease - with whether or not they wish to donate their organs after death now also included. Residents keen to become donors have to follow four simple steps, the first of which is to download the ‘Hayat’ mobile application. After they submit their basic details (such as their name, age and Emirates ID number) via the app, an email is sent to the individuals’ registered address that, when confirmed, confirms their place on the donor register. Director of public health policy at the Ministry of Health, Lubna Al Sha’ali, highlighted the important role that technology will play in the development. She said: “The third phase we will use artificial intelligence to match donors with recipients based on Human Leukocyte Antigen matching and DNA verification. “This data will be stored with us for use in future if the donor dies and their organs can be harvested.” The United Arab Emirates is still one of the most popular locations we work with. Would you be interested in a move to the country? If so register on our website today, a dream job could be far closer than you might imagine.

W1siziisijiwmtkvmdivmdyvmtmvndivntcvmte1l09kexnzzxlhdwlkzu1hbhrhlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to Malta

Malta probably isn’t somewhere that you’ve considered moving, with the small Mediterranean island often thought of as more of a holiday destination for Europeans. That might be changing however, with the country keen to grow the healthcare sector that once saw it named the Nurse of the Mediterranean. Find out more about Malta’s plans to develop healthcare in our exclusive feature. Where to live? Despite its small size, Malta can offer a range of living options that are sure to suit almost everybody. For those looking to be in the heart of the action, the capital city Valletta is by some distance the best option. A UNESCO World Heritage Site, Valletta is steeped in Baroque charm and home to a stunning natural harbour. For those looking for a slightly more contemporary lifestyle then the nearby town of Sliema is upbeat and vibrant, with property prices slightly lower than those in the capital. Both of these options involve bustling towns however, and we know that isn’t for everyone. If you’re looking for a more relaxed pace-of-life then the south of the island could be more attractive - especially the small fishing town of Marsaxlokk. Not only does it offer a slower lifestyle, it’s also based around a stunning bay and home to a friendly, mainly local, population. What is there to do? As somewhat of a tourist hub for Italians, Spanish and British, there is plenty to see and do in Malta. St John’s Co-Cathedral - Arguably the most beautiful and iconic building in Malta, St John’s Cathedral was built between 1573 and 1577 and remains one of the most popular attractions on the island. Mdina Old City - Fans of historical architecture are well served in Malta, with Mdina Old City the perfect place for a leisurely stroll through the country’s rich past. Playmobil-FunPark - Totally changing the tone is Playmobil FunPark, the second largest Playmobil factory in the world and home to plenty of themed activities for children Where am I likely to be working? Malta is a small island, and as a result the majority of major hospitals are based in and around the capital city, Valletta. This is where we’d imagine that you’ll be working, but commuting in to the city from around the island is easy - it takes under an hour to drive from Millieha in the north to Tal-Papa in the south - so living and working in different towns shouldn’t create much of an issue. Who is suited to a move? We think that Malta’s relatively relaxed pace of life and need for experienced medics makes it ideal for older professionals looking to get the most out of their careers. That’s not to say that Malta doesn’t work for younger medics with families, the island is safe, home to plenty of good schools and has plenty to keep children occupied - but further afield locations like Australia and New Zealand can probably offer more. Why move? Here are five of the best reasons to move to Malta today: 1 - The cost of living in Malta is low, especially for basics like food and utilities. 2 - Malta gets 300 days of sun every year - and winters are short and relatively warm. 3 - Malta is home to one of Europe’s best healthcare systems. 4 - The typical, relaxed island pace of life can be a great change from the hectic lifestyle endured in mainland cities. 5 - Despite having its own rich culture, Malta is very near mainland Europe. Plenty of cheap, quick flights to Italy, France, Switzerland and Greece are available - making it the ideal place from where to explore the region. Interested in Malta? We’re hoping to bring a new range of jobs from the country to our website very soon. To get ahead of the rest register online today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdivmdyvmtmvndyvmjkvodc4lze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Saudi Tackling Tobacco

Saudi Arabia’s Ministry of Health has followed World Health Organisation advice by launching a nationwide survey on tobacco use. Targeting 12,800 respondents over the next two months, hopes are high that the results will allow the Saudi Government to implement more successful strategies aimed at reducing tobacco use in the Desert Kingdom. The most recent statistics have shown that around 12% of Saudis over the age of 15 regularly smoke tobacco - a figure slightly below that of the UK and UAE, but still above Qatar. Estimates suggest that smoking costs the global healthcare market more than $420bn annually, making it vital that rates continue to drop. Along with the WHO survey, Saudi Arabia has also been proactive on its own, introducing a smartphone application that allows users to report people for smoking in public areas, or any shops that sell cigarettes to children. As well as this nationwide strategies have also been introduced to raise awareness of the health issues caused by tobacco consumption, with hopes high that the Kingdom will be able to stub out the habit in the not too distant future. Would you be interested in a move to Saudi Arabia? We’ve currently got a range of openings in the Kingdom on our website, with a number of attractive posts available in Buraydah. Find out more and apply online today.

W1siziisijiwmtkvmdevmzevmtavntqvnduvndqylze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Thinking of a Move to Saudi Arabia?

Anyone looking to work in Saudi Arabia’s healthcare sector will need to complete their ‘DataFlow’ before taking a role Odyssey have been informed. DataFlow is the name given to the primary source verification software used by the Kingdom’s healthcare sector, with candidates uploading personal documents to prove their credentials. Our contacts in the Kingdom have been in touch to advise us that employers are unlikely to book a new employees’ flight or accommodation until their qualifications, employment history and medical licenses have been verified by DataFlow. Whilst this can be an inconvenience, it also represents a great opportunity for medics keen on a move to the Kingdom to get ahead of the rest. Completing your DataFlow, which will take a few hours online if you have the documents to hand, and then around a month to verify, can help to give you the edge when competing in a competitive market. For more information, and to start your application, visit the DataFlow website.

W1siziisijiwmtkvmdevmzevmtavntcvntcvode3lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Early Risers at a Lower Risk of Mental Illness

Early risers are at a lower risk of mental health issues than those who struggle with mornings according to a major new report. The genetic study of more than 700,000 people, co-authored by academics at Queensland University Australia, revealed that those with a genetic disposition to wake earlier found themselves at a far lower risk of schizophrenia or depression than those who found themself comfortably able to stay awake all night. This builds on previous studies which have put so called ‘night owls’ at a higher risk of depression, type-two diabetes and obesity. The role of the body’s biological clock is vital in understanding a person’s natural routine, with the study showing that early risers’ fitted perfectly with a standard 9-5 day - whilst night owls’ did not. Contrary to public beliefs it isn’t possible to become a morning person either, with an individual's’ genetic identity playing a vital role in deciding how easy someone found getting up outwith their natural routine. Are you more of a night owl or an early riser, and how does this relate to the rest of your family? Let us know on our social media channels.

W1siziisijiwmtkvmdevmzevmtevmtevmdqvmzmxl09kexnzzxlhdwlkzuf1y2tsyw5klnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to Auckland

New Zealand has always attracted a steady stream of people seeking a better life overseas, and Auckland is often the most sought after destination. Ranked as the third best city in the world for quality of life, it should come as little surprise that a move comes at a price - however it’s one worth paying if you’re looking for a lifestyle enhancing change. Where to live? Auckland has plenty of locations to choose from for all kinds of expats. Whether you’re a young medic looking for a vibrant community, or a more experienced physician seeking a slower pace of life, here are three of the most popular. Best for young medics - We’ve had a few more junior roles on offer in Auckland over the past year, and Ponsonby is always popular with a young crowd. Close to the city centre, but with a bustling selection of independent businesses and a great local music scene, it’s perfect for someone looking to be in the heart of the action. Best for families - Parnell is one of New Zealand’s most sought after locations, sitting just two kilometers from the city centre, it offers a slower pace of life, high quality local amenities and some stunning family homes. Best for more experienced medics - Mangere Bridge is ideal for those seeking a quieter life, whilst still being only half-an-hour from the centre of Auckland. This scenic little suburb can offer great accommodation and a range of community groups. What is there to do? Queen Street - Auckland’s main shopping area, Queen Street is in the bustling heart of the city. Auckland Art Gallery Toi O Tamaki - Host of the biggest collection of national and international art in New Zealand, this isn’t one to miss out on. Waiheke Island - No visit to New Zealand would be complete without visiting a vineyard, and Waiheke Island is home to one of the country’s most scenic. Where am I likely to be working? When you first move to New Zealand it’s likely that you’ll be working in a more rural setting away from major cities like Auckland, however if you do manage to find a role in the city then it’ll likely be in a medium sized hospital. Aside from Auckland City Hospital itself, Auckland has few large medical facilities - allowing physicians to build up a strong relationship as a member of a smaller team. These can offer a high standard of care within a modern environment. If a move to Auckland is more of a long-term goal, and you’re working outside of the city, then you’ll likely find yourself in a District Hospital. Again these tend to be relatively small in size, but play a vital role in the healthcare of a semi-rural community. Who is suited to a move? We believe that a move is perfectly suited to someone looking for a long-term relocation. Auckland’s high standard of living, educational facilities and medical care makes it idea for raising a family - whilst New Zealand’s stunning scenery and busy cities can be great fun to explore. For someone moving from Western Europe there will be little culture shock and - distance aside - it’s hard to think of an immediate downside. If you’re solely focused on enhancing your finances, or experiencing a totally unique culture, then we’d probably recommend elsewhere, however for anyone else few locations can offer such long-term stability as New Zealand. Why move? Here are five reasons to go for it! For more information on moving to New Zealand, and the latest job alerts from the country, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmjmvmtqvmzavmdyvnzyxlze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Australia Targets Sugary Drinks

A controversial new advertising campaign raising awareness of the impact sugary beverages can have on dental health has been launched in Australia. Labelled ‘misguided’ and ‘lacking evidence’ by the Australian Beverages Council, the new joint group campaign shows glamorous soft drink consumers with rotten teeth and serious dental decay. The Australian Dental Association and Diabetes Australia are two of the biggest supporters of the new campaign, with a total of 14 community health groups calling for the implementation of a new six point plan to reduce consumption in the country. This comprises: A 20% levy on sugary drinks A Government backed marketing campaign to raise awareness of the health risks associated with sugary drinks Restrictions on marketing targeted at children Restrictions on the sale of beverages at schools, state buildings and children’s sports events State policies to reduce the availability of sugary drinks in the workplace Easy access to fluoridated tap water Dramatic tooth decay has been found in people who consume more than 1.5 litres of sugary soft drinks daily, with hopes high that the shocking nature of the new campaign will get it noticed by more young people. Do you support the use of more graphic imagery in raising awareness of the health issues caused by unhealthy lifestyle choices? Let us know on our social media channels.

W1siziisijiwmtkvmdevmjmvmtqvmjmvmdavnjk4l09kexnzzxlhdwlkzuplzgrhac5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

The Odyssey Guide to Jeddah

Expats moving to Saudi Arabia tend to end up in either Riyadh or Jeddah. Both cities are home to high quality healthcare facilities, plenty of amenities and expat-friendly compounds. Jeddah’s more relaxed atmosphere however makes it a particular favourite, especially with those looking for a less intensive Saudi experience. Where to live? Most expats moving to Jeddah will choose to live in one of the city’s compounds. These offer a very secure, almost Western standard of living, with impressive villas, apartments and communal facilities that make them ideal for families. Arabian Homes are one of the most established compound suppliers in the region, and they run four villages in Jeddah - all of which are located near the airport and other local attractions. Elite Compounds and the recently constructed Divona also offer a high quality of living, however they are far from the only attractive options. If you’re more adventurous, or keen to maximise your money, then you can live in the city itself, however standards and security levels are far lower than in the compounds, so we would only recommend this to someone with a decent knowledge of the city. What is there to do? Many people moving to Saudi Arabia are put off by the lack of tourist attractions, however that is slowly changing as the Kingdom starts to open its doors to more and more visitors. Here are three things to consider visiting: Fakieh Aquarium - One of Saudi’s premier tourist attractions, the aquarium is home to a fascinating selection of marine life. Athr Gallery - A thought provoking contemporary art gallery located just off Jeddah’s main shopping area - Tahlia Street. Al-Shallal Theme Park - Covering 60,000 square meters this park has long been popular with families. Where am I likely to be working? Jeddah is home to some excellent public and privately owned hospitals and medical centres, and the demand tends to change depending on when you are looking to start, the speciality and your qualifications. At the moment we’ve got a range of openings in Government owned facilities. The Saudi Ministry of Health has split the healthcare system into four - with public hospitals, Ministry of Defence and Aviation (MODA), Interior Ministry (MOI) and Saudi National Guard (SANG) facilities Kingdom-wide. These all offer a high standard of care, attractive salary packages and good locations in the heart of the city. Who is suited to a move? Saudi Arabia is well suited for an experienced medic looking to increase their savings, via a short-term move overseas. Most people moving to Saudi only stay for between two and four years, which is enough time to sample the culture, boost your bank balance and test your professional skills within a new environment. As with the rest of the Gulf a lot of focus is placed on the importance of working independently, so we’d only recommend it to someone with a decent chunk of post-qualification experience back home. Why move? Looking for a few reasons to move to Jeddah? Here are five: 1 - You’ll be given more responsibility within the hospital, thus having more freedom to tackle cases in the way you believe best. 2 - Financial attractions are a given, high tax-free salaries and a relatively low cost of living makes moving to Jeddah extremely lucrative. 3 - The city is home to a vast range of restaurants, serving incredible food from all around the world. 4 - A move to one of the Gulf’s most historically significant cities can be a unique cultural experience. 5 - Jeddah itself looks absolutely beautiful at night, when lighting turns it from a sandy, dusty beige into a warm gold and black. If a move to Jeddah is something that would interest you register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmjmvmtqvmjuvndavmze0lze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Elementary Health Checks in Saudi

Saudi Arabia’s Ministry of Health has launched a new campaign focused on the wellbeing of school children in the Kingdom. Government officials are hopeful that the new joint Ministry of Health and Ministry of Education venture will reach around 50% of the country’s elementary school pupils, with the scheme encouraging healthy lifestyles and carrying out a range of tests aimed at detecting any future health issues at an early stage. The tests will cover an array of areas; from dental health to vision, hearing and behavioral examinations. A social media campaign is also being launched to help raise awareness for those who aren’t taking part, with the importance of regular check-ups and early diagnosis being stressed throughout these. Saudi Arabia has a major issue with childhood health, with WHO statistics showing that a staggering 17.1% of children under the age of five are overweight or obese in the Kingdom. Not only will this put them at a greater risk of serious health issues in later life, it can also put a major strain on the country’s healthcare system. Would you like to help Saudi in its quest to help young people to make healthier choices? If you would, register on our website today for job alerts. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdevmtcvmtavmtkvntcvmzu1lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Northern Territory Suicide Hotspot

More than three times as many children are taking their life in the Northern Territory when compared to other Australian states a new report has revealed. Australian National Bureau of Statistics figures have shown that there have been 13.9 deaths per 100,000 young people in the Territory, whilst in other states this ranged from just 1.7 to 3.6. The figures for indigenous groups are especially concerning, with almost half of all young people taking their life in the country being from that demographic - despite them making up less than 5% of the total population, with one victim being as young as 12 years old. Northern Territory appears to have a major issue with people being prepared to seek support, with just 0.4% of the suicide prevention helping ‘Lifeline’ coming from the region. This is despite more than $53m being spent on local mental health services, including campaigns aimed at de-stigmatizing the image of mental illness. Government officials are now targeting greater community healthcare programmes, to help reach out to Territorians - and especially young people - from an early stage. Could you help Australia as it continues to battle mental illness? Register on our website today for job alerts. A dream move could be closer than you might imagine.

W1siziisijiwmtkvmdevmtcvmtavmtivntgvnjyxl1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

New License in Dubai

Visiting physicians, dentists and allied health professionals will soon be able to apply for a two year ‘Visiting Doctor’s License’ in Dubai, allowing them to work in up to three facilities in the healthcare city development. The move has been introduced in an attempt to attract more highly qualified Western physicians to the Emirate, as part of the ‘50 Year Charter’ initiative that aims to improve the quality of life for everyone living in Dubai. Currently visiting medics are only able to apply for short-term licenses which have to be renewed every three months, however from January 20 the new option will offer greater long term security. Anyone eligible can apply online from overseas and once a letter of acceptance has been received they’ll be able to sponsor their family - with Dubai Healthcare City itself sponsoring the individual. Speaking about the new license, CEO of Dubai Healthcare City Authority, Dr Ramadan Al Blooshi, said: “Attracting global medical expertise to serve the health of our citizens is one of the main pillars of the transformation of Dubai's medical system." "The new 'Visiting Doctor's License' will help us to achieve this as it provides flexibility and mobility for global, high-caliber physicians wishing to work in Dubai Healthcare City, consequently increasing unique expertise in the free zone.” Anyone eligible can register on the DHCR website.

W1siziisijiwmtkvmdevmtyvmtqvndgvmtcvndg2l09kexnzzxlhdwlkzvnoyw5nagfplnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to Shanghai

Shanghai is one of the most sought after locations in the Far East for expats seeking a move to the region, and thanks to recent developments we’ve got a range of openings on offer in the city. Before committing to a move however, we’ve made a little guide to let you know what to expect. Where to live? Shanghai is enormous, and so choosing where to live is likely to depend on whereabouts you’re working. Most of the popular expat areas are near the best international schools however, with Hangqiao and Pudong two of the most sought after thanks to their high quality accommodation, local amenities and proximity to major airports. Most expats will likely live in a high rise apartment block, with these offering a comfortable, spacious standard of living - however a small number of townhouses are available too, though they can come at a premium. What is there to do? As you’d expect from such large city, with such a rich history, there is plenty to see and do around Shanghai. Nanjing Road - The most popular shopping street in the city, Nanjing Road is home to plenty of world famous brands, and smaller independent retailers. Shanghai World Financial Centre Observation Deck - On a clear day nowhere can offer as stunning a view of the city as one of the world’s highest observation decks. Zhujiajiao Water Town - Shanghai has an image as a modern metropolis, however venture a short distance outside and you can feel as if you’ve stepped back in time - with the Zhujiajiao’s history stretching back for more than 1700 years. Where am I likely to be working? As China continues to develop and invites more private investors into the country, Shanghai’s healthcare sector continues to grow. This is happening exponentially at the moment, and so it’s difficult to provide an exact hospital name or location. What we can say however is that it’s likely that you’ll be working within the private sector, probably for a facility joint managed by both Chinese and International companies. Who is suited to a move? We think that a move to China is ideal for an experienced expat medic, seeking to make a real impact overseas. As many of the facilities have only recently opened they are looking for well-trained medics to take on management and teaching roles. Salaries, whilst high, are subject to taxation (unlike in the Gulf) and hours can be long, so a move isn’t suitable for someone looking to wind down their career whilst exploring a new country. Why move? There are a vast range of reasons to move to Shanghai. Here are a few of the best. Cultural Experience - Moving to China is a unique cultural experience, and moving to Shanghai can offer a great blend between modern and traditional China. Influence - A move to Shanghai represents an opportunity to make a real difference, where you can introduce the foundations for the future of healthcare in the city. Safety - Despite the size of the city, Shanghai is extremely safe for expats. Futureproof - China is home to one of the world’s fastest developing economies, and with the Gulf slowing down slightly a move to China can be close to futureproof. Public Transport - Getting around Shanghai can seem daunting, but the city (and China in general) is home to a great public transport system - that makes exploring easy. For more information about moving to Sharjah, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdkvmtqvndivmzgvmjgzl01hbhrhrmvhdhvyzs5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Malta - Europe's Healthcare Hub

Malta has set its sights on becoming a European healthcare hub, by inviting private investors to make the island a health tourism capital. Despite its small size, Malta has a rich history as a healthcare power. From opening its first public hospital back in 1327, to providing healthcare during World War 1, it’s little surprise that the country is known as ‘The Nurse of the Mediterranean’. Now however it’s keen to start developing for the future, by investing in world class technology and talent to cement its position as a hub for health tourism. To combat the demands that come with an ageing population, the Maltese Government has introduced policies aimed at attracting private investors. A major part of this has been the establishment of new partnerships with international healthcare providers and some of the world’s most highly regarded medical schools. Of the healthcare groups entering the country, Vitals Global were one of the first, with the group investing €220m in two Maltese hospitals and one in the nearby island of Gozo, aimed at attracting medical tourists from throughout Europe. After two years the Maltese arm of VG was bought out by Texas based Steward Health Care, who have continued to develop facilities in the country. Medical tourism isn’t the only focus in Malta however, the country is also committed to investing in the next generation of doctors, nurses and allied health professionals. A brand new medical school in Gozo opened its doors in September 2017, run by Barts and The London School of Medicine and Dentistry, whilst the Royal College of Surgeons Ireland made Malta a centre for examinations. That means that a move to the country isn’t just for someone looking to develop their own professional skills, it’s also ideal for someone interested in educating the next generation of medical staff. Is a move to Malta something you’d consider? At the moment we only have one vacancy in the country, but we’re expecting that (and interest) to grow exponentially over the coming year. To get ahead of the rest register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdkvmtqvmzgvmzcvnzuylze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Boost for Mental Health in Australia

Headspace, one of Australia’s biggest youth mental health organisations, is to benefit from an additional AU$47m in funding. Established by the country’s government 13 years ago, the group offers support to young people between the ages of 13 and 25 on a range of topics, from anxiety to family issues. Currently the group operate more than 100 facilities nationwide, with the new grant ensuring their future until at least the winter of 2023. The funding boost will also allow for new techniques to be introduced, after recently released statistics showed that almost 500,000 people between the ages of 16 and 24 experienced a mental health problem each year. This will include a nationwide roadshow where young people will talk about their mental health challenges, and how Headspace has supported them. Hopes are high that greater support from an early stage, along with greater visibility of positive role models will help to remove some of the fear and stigma surrounding mental illness. Speaking about the funding boost Greg Hunt, Health Minister, said: “If we can take the steps in the early years to give people a pathway to recovery, then we can make a lifelong difference in terms of their quality of life, their experience and their families lives.” Would you be interested in helping Australia as it battles sky-high youth mental health rates? Register on our website today for job alerts. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdkvmtqvmzuvmzivnti2l09kexnzzxlhdwlkzvnoyxjqywgucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

The Odyssey Guide to - Sharjah

Sharjah is often overlooked by expats seeking a move to the United Arab Emirates, despite being close to Dubai - and offering a high standard of living at a fraction of the price. Recently the Emirate has started developing its medical education infrastructure too - making it even more attractive to medics looking to make the UAE their home. Where to live? Sharjah is a relatively small Emirate compared to Dubai, and is home to just 1.4 million people (compared to Dubai’s 3.1m) making it ideal for expats seeking more space for their money. Al Qasimia near the iconic King Faisal Mosque is a popular location, with plenty of shops, supermarkets and restaurants within easy walking distance. If you’re looking for a more scenic outlook then the waterfront town of Al Khan is popular - especially with those who are into watersports. If you’re moving with a young family and are keen to take advantage of the extra space that a move to Sharjah can allow, then Al Falaj is a great option. It’s one of the most sought after addresses in the Emirate, and is home to some stunning family villas. What is there to do? Sharjah might not be home to as many attractions as Dubai, but it does have a name as the UAE’s cultural capital. Sharjah Art Museum - Has two floors of art on display, from historical pieces to more contemporary work. It also hosts travelling exhibitions. Al Mahatta Museum - Did you know that Sharjah was home to the first airport in the Gulf? You do now. Al Mahatta explores the history of air travel in the Emirates. Khor Kalba Conservation Reserve - Aside from the museums, Sharjah is also home to a beautiful unspoilt nature reserve - home to plenty of stunning native species. Where am I likely to be working? Al Zahra and Zulekha Hospital are arguably two of the most popular with expats in Sharjah, and both offer high quality facilities. The state owned University Hospital is another option, albeit openings within the public sector are rare, and often struggle to match the salaries paid in the public sector. It’s also possible to work in Dubai and commute, but travelling times during peak hours can be lengthy - so we wouldn’t recommend this. Who is suited to a move? Sharjah is ideal for someone looking to boost their finances, but without the restrictions that can be found in Saudi Arabia. Being located near Dubai means that there is plenty to see and do for all ages and interests, whilst the Emirates’ private schooling system is impressive. If you’re looking for a career boosting move however then locations such as China and New Zealand can provide a better option to enhance your skills, whilst the stifling heat (and unique culture) of the Gulf means that isn’t ideal for everyone. We think that a move to Sharjah suits someone seeking the financial benefits of living in the Gulf, but not someone looking at a longer term move. Why move? There are plenty of reasons to relocate to Sharjah, here are five of the most convincing. Finances - A low cost of living, and tax-free salary packages is a recipe for success. Surroundings - Unlike Dubai, Sharjah still retains plenty of traditional Arabic charm Culture - Sharjah is home to a range of museums, all of which are cheap (or even free) to visit. Weather - Year round sun and heat makes the country ideal for those who hate cold winters and wet summers Healthcare - With land expensive in Dubai and Abu Dhabi, Sharjah is becoming a popular location amongst healthcare providers looking for space and value. For more information about moving to Sharjah, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdqvmtavmjyvmtcvnzyxlze5u2luz2fwb3jltmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Singapore to Ban Sugary Drinks?

It’s been revealed that Singapore could become the first country in the world to introduce an outright ban on sugary drinks. Already known globally for its ban on chewing gum, the country’s Ministry of Health are now seeking views on four proposals targeting beverages packed with excessive sugar. These comprise an outright ban on pre-packed drinks containing more of six teaspoons of sugar, the introduction of a single or tiered tax on high sugar drinks, mandatory front of packing warnings about the sugar content, or a nationwide ban on all adverts for beverages that are high in sugar. At the moment sugary drinks are already banned in schools and government buildings, however with almost half of Singapore’s sugar intake coming from drinks further action is urgently required. Sugary beverages aren’t the only unhealthy lifestyle choice being targeted on the island however, with Orchard Road becoming the first smoke free area in the country. Introduced on January 1, those looking to light-up are now only permitted to do so within designated smoking areas around the precinct. At the moment they’ll only be asked to move to these areas by wardens - however by spring enforcement action will begin to be taken. Citing the success of Scotland’s 2006 smoking ban, and the positive impact of not exposing people to passive smoking, experts are now hopeful that the ban will encourage more people to stub out the habit. Running for over 2.5km between Tanglin Mall and Dhoby Ghaut Metro Station, the scheme could be a prelude to a much larger nationwide ban. Singapore is home to one of the most dynamic and forward thinking healthcare sectors on the planet. As a result job opportunities are infrequent, and employers are always looking for the highest quality of candidate. To get ahead of the rest register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdqvmtavmjevmjcvnjcylze5s1nbtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Saudi King Passes Health Reforms

Saudi Arabia’s King Salman has given royal approval to a number of changes in healthcare policy, including the establishment of a new centre focused on evidence based practice. Whilst the new facility dominates the headlines the King has passed a range of new suggestions made by the Saudi Health Council, aimed at further developing the already strong sector for 2019. A national registry of tumours is to be introduced, ran by the Saudi National Oncology Centre. It is hoped that this will allow the prevalence of Cancer to be easily monitored, with all hospitals and clinics in the Kingdom asked to work collaboratively in an attempt to reduce rates of the condition. Further to this, new laws will make it mandatory for all hospitals with appropriate facilities to receive heart attack patients transferred by the red crescent, whilst standardised laboratory measurements will be used nationwide for the very first time. Secretary general of the Saudi Health Council, Dr Nahar Al-Azimi, thanked King Salman for supporting the group’s decision. He said: “The approval reflects King Salman and Crown Prince Mohammed bin Salman’s keenness to improve the quality of life of people of Saudi Arabia. “Regarding oncology services in the Kingdom, specialised hospitals and medical cities have been directed to activate a hub-and-spoke cooperation program. This will be implemented in two phases. “In the first phase, oncology units in Arar, Madinah and Asir will be linked to specialised hospitals, and in the second phase, specialized hospitals will provide other health facilities with studies and relevant work plans.” Would you be interested in a move to the unique and historic Desert Kingdom in 2019? Register on our website today for job alerts, a dream move could be far closer than you might imagine.

W1siziisijiwmtkvmdevmdqvmtavmtcvmdgvodi4l09kexnzzxlhdwlkzvblcnrolnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

The Odyssey Guide to...Perth

Perth is the largest city in Western Australia, and one of the biggest in the country. Often described as the world’s most remote city - it sits more than 2,100 kilometers from the next nearest Australian city, Adelaide. Perth is a vibrant hub, flanked by attractive suburbs and miles of stunning coastline. Who is suited to a move? Relocating to Australia is ideal for a medic with a decent wedge of experience back home, but with a desire to take their skills overseas as part of a long-term move. The country is fantastic for raising a family and, unlike some locations in the Gulf and Asia, many people make a move from Europe and don’t return. Perth is home to a relatively young workforce, and as a result there are plenty of opportunities for recently trained medics. After three, four of five years experience in your homeland you should be ready to make a real impact. If you’re looking to leave Britain, Europe or America behind for good, but don’t want a totally alien culture, then Australia (and Perth especially) is probably an ideal location. What is there to do? Perth has plenty of attractions, but here are three of the most popular. The Art Gallery of Western Australia - For fans of both traditional and contemporary art, the Art Gallery of WA is home to one of the finest collections in the country. Having first opened its doors in the late 1800s it is one of the most historic galleries in the country, and that is reflected in the rich collections on display. King’s Park and Botanic Garden - If you’re moving to Australia you’ll want to spend some time outside, enjoying the great weather and stunning scenery. Where better to do that than in King’s Park? Located near the main business district of the city, it’s an oasis of calm that can feel like another world. The WACA - Cricket seems to be a very popular hobby with many of our candidates, and in Australia it’s part of everyday life. The world renowned WACA isn’t just an impressive stadium either, it’s also home to a museum looking at the history of the sport - and others - in Western Australia. Where am I likely to be working? For some cities and towns this is easy to answer. There are often only a small number of high quality medical facilities, and so it’s easy to pinpoint the main hospitals and clinics. In Perth this isn’t the case however, with a vast array of hospitals, clinics, health centres and GP surgeries all operating to a high standard. If recent trends are to be replicated however, we’ve seen a large demand for General Practitioners in the area. Almost exclusively these roles are within neighbourhood practices - based out of the city centre in the smaller suburban towns. Where to live? Perth has plenty of attractive places to live, from modern apartments in the heart of the city, to spacious villas in quiet suburbs. Where you’ll work will probably decide where is best for you to live, but the city’s strong infrastructure makes it relatively easy to commute into the heart of the city from anywhere nearby. East Perth was recently named as Australia’s most lifestyle friendly suburb, mixing green space with a quick and easy commute to the city centre. Prices are high here, and space can be at a premium, so many people choose to look further afield at places like Swanbourne, Ashfield or Highgate. Here prices are considerably lower, allowing you to get more space for your money, whilst commute times remain manageable. Why move? How many reasons to you need for moving to Perth? How about five? The Lifestyle is great. Laid back and relaxed, but with a buzz that other Australian cities can’t match. Perth is home to plenty of job opportunities, especially for General Practitioners. A lower cost of living than many other major cities in Australia - with property prices considerably lower than in Melbourne or Sydney. Last year Perth became the first city in Australia to offer a direct flight to London - making travelling home a whole lot easier. Perth’s architecture and history make it an extremely attractive place to call home. Don’t fear that you’ll be living in the dusty outback, there are plenty of attractive historical buildings, and modern skyscrapers. For more information about moving to Western Australia, register on our website today. A dream move could be far closer than you might imagine.

W1siziisijiwmtgvmtivmjcvmtevmtyvntmvnjqvvufftmv3cy5wbmcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Cost of Healthcare Rising in UAE

Healthcare costs in the United Arab Emirates are on the rise according to a newly published report. Analysing data from 2017, the cost of medical support in the Emirates rose by 9.9% over the year - a remarkable 20% higher than the increase recorded in Singapore. In the report, published by global investment advisors Willis Towers Watson, medical inflation globally has been shown to sit at around 10% - creating a greater than ever need for more sustainable and managed healthcare solutions. Speaking about the challenges facing the Emirates, Simon Stirzaker, regional health and benefits leader at Al Futtaim Willis, said: “Medical costs in the UAE are clearly rising at an unsustainable rate - if medical inflation continues on its current trajectory then the cost of providing medical insurance benefits will become higher than payroll. “A key part of the problem is that the consumers of healthcare services (workers who are insured) tend to be disconnected from the actual cost of the services they are using. “Despite this The UAE has made significant and admirable progress in the health care sector, particularly in facilitating access to quality health care for its residents. “The challenge now is to build on these achievements whilst controlling costs.” Would you be interested in a move to the UAE in 2019? Register on our website today to start your journey - a dream role could be closer than you might imagine.

W1siziisijiwmtgvmtivmjcvmtevmtivmtuvmtc5lze5q2hpbmfgzwf0dxjllmpwzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Make the Move 2019 - China

It’s at this time of year that many people start considering (or in many cases start re-considering) the idea of a move abroad. A new year brings with it new hopes, a fresh start and the opportunity to do something you’ve been hoping to do for a while. So why not make 2019 the year you finally go for that new life overseas? Over the final five weeks of 2018 we’ve looked at a select group of the countries we work with, and examined why you should make the move in 2019. During this we’ve recapped some of the major news stories from 2018, what sort of person would be suited to a move, and what the future could have in store. In the final installment in the series we’re going to taking a look at China, a global superpower with an exciting future. What made the news in 2018? China has always been fairly cautious when publishing health news and so, unlike many Middle Eastern locations, stories only hit the headlines occasionally. Despite that however we still have plenty to round up from a busy year in the country. This started in April when data from the Lancet showed the scale of China's COPD problem. According to the report almost 100 million Chinese people are now suffering from the condition - a staggering 8.6% of the country’s total population, with the research - which screened the lungs of more than 50,000 participants - considered the most comprehensive ever conducted in the country. During the same month China's pollution rates were also shown to have dropped - although they remain dangerously high in some industrial parts of the major cities - potentially damaging the health of many generations to come. As we moved into Summer, new World Health Organisation data showed that China now tops the UAE in terms of healthy life expectancy for the very first time. We then turned our attention to exclusive features as more and more candidates began to express an interest in working in China. Firstly we looked at five things you should know about Shanghai, before focusing on five things you should experience in the stunning modern metropolis. Cancer took the headlines in August, with care becoming more affordable thanks to a new partnership between the country's state medical supplier, and pharmaceutical giants. The year ended with another duo of features. First we took a look at five things you should know about Guangzhou - an increasingly popular location with expats that is often overlooked in favour of cities like Shanghai, before our 'At a Glance' series took a brief look at every aspect of life in the country. Who is suited to a move? We'd ideally recommend to people who fit two categories. Firstly, experience is vital. You'll be acting as a leader in the country, training up the next generation of local medics and implementing professional techniques department-wide. Secondly motivation is key. A move to China will be hard work, but the impact you can make (and legacy you can leave) will be a great reward. If you're looking for a move purely to enhance your finances, or key to wind down, then we'd recommend looking elsewhere. What does the future hold? This is where China excels. The future looks extremely exciting. China is home to one of the world's fastest growing economies, and with a rapid transition from an industrial to blue collar economy a move is futureproof. If you're looking for long term stability then few locations can rival the Far East - and especially China.

W1siziisijiwmtgvmtivmtkvmtqvmdkvndqvoti4lze5q2fuywrhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Smoking Rates Shock in Canada

For years smoking rates in Canada have been falling. Now however they have started to creep back up, prompting calls for expert assistance. According to the latest statistics 16% of Canadians over the age of 25 now regularly smoke tobacco, a figure that has grown by 3% compared with the previous 12 months. Canadian health officials have worked tirelessly to reduce smoking rates, with the introduction of graphic warnings on packaging, comprehensive education programs from a younger age, and even freephone telephone numbers offering support to anyone trying to kick the habit. Now calls are being made to assess how effective these programs have been, as the country aims to reduce rates nationwide to just 5% by 2035. Research published recently in the United States has shown that mortality rates caused by smoking have actually risen of the last half century - with the use of tobacco not becoming any safer with time. In a statement Health Canada defended their current policies, and highlighted that a review wasn’t related to any failures. It read: “The government of Canada is committed to evaluating our programs to ensure that we are delivering value to Canadians. “This ‎contract is intended to bring in experts to help us evaluate the value of the previous tobacco strategy, and the benefits it has delivered to Canadians. This is a standard part of regulatory and policy development. The results of this evaluation will inform future strategies and policies.” Canada has been a popular location for expats seeking a better life overseas for many years now. To find your perfect role register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtivmtkvmtqvmdqvntyvodgvmtlhdwxmrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

'Diabesity Epidemic' in the Gulf

Shocking new figures have shown that the number of diabetics in the Middle East and North Africa (MENA) region will grow by 110% by 2045. According to the statistics, published ahead of January’s Arab Health summit, only Africa is set to see a higher growth in the percentage of people battling the condition - with it projected to rise by a staggering 156%. Diabetes is already a major issue in the Middle East, with the region home to some of the world’s highest rates of the condition. Kuwait, Qatar, Saudi Arabia, Bahrain and the UAE already have some of the highest prevalence rates globally - with the economic burden expected to reach $35.5bn by 2045. This, along with skyrocketing obesity rates, has been called the Gulf’s ‘Diabesity Epidemic’, and experts have been quick to highlight the major reasons for the issues. Hyper-urbanisation has created an environment built with transportation, not pedestrians in mind, whilst traditionally sedentary lifestyle are now being compounded by unhealthy diets and an increasing reliance on sugary treats and junk food. Speaking about the issues, and his hopes for the upcoming conference, Arab Health Exhibition Director, Ross Williams, said: “With health professionals and researchers considering ‘Diabesity’ as potentially the greatest epidemic in human history, the advancement of communication technology, telehealth and the application of Artificial Intelligence is now playing a critical role in management of chronic illnesses such as diabetes and obesity. “The economic and societal impact of the epidemic is a catalyst for the entire healthcare industry to come together to offer collective solutions to this global problem.” “The Diabetes Conference at Arab Health is the perfect platform to bring together all stakeholders - from government authorities to the region’s leading diabetes experts - to assess the various public health measures and technological advancements that can be adopted in order to tackle the growing burden of this epidemic.” Would you be interested in helping the Gulf in the region’s battle with ‘Diabesity’? We’ve got a rich network of clients throughout the region, meaning that a dream job could be far closer than you might imagine. Register on our website today to start your Odyssey.

W1siziisijiwmtgvmtivmtkvmtqvmdevndevmtgwl1vbruzlyxr1cmuucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Make the Move 2019 - UAE

It’s at this time of year that many people start considering (or in many cases start re-considering) the idea of a move abroad. A new year brings with it new hopes, a fresh start and the opportunity to do something you’ve been hoping to do for a while. So why not make 2019 the year you finally go for that new life overseas? Over the final five weeks of 2018 we’re looking at a select group of the countries we work with, and examined why you should make the move in 2019. During this we’ve recapped some of the major news stories from 2018, what sort of person would be suited to a move, and what the future could have in store. In the penultimate installment in the series we’re going to taking a look at the United Arab Emirates, still the most popular country we work with thanks to its world leading salaries, and high standard of living. What made the news in 2018? It was a typically busy year of health news in the Emirates, with new facilities, studies and achievements regularly making the press. The first major story of the year saw a team of medics from Abu Dhabi's Danat Al Emarat Hospital save the life of a 48 hour old child born with a large Ovarian cyst. Later in the same month it was revealed that patients in Dubai have positive attitudes towards Artifical Intelligence in healthcare, whilst a team at Latifa Hospital in the Emirate saved the life of a child born after just 24 weeks. In March Al Qasimi Hospital in Sharjah became the first in the Middle East to take on the latest generation of robot assisted Percutaneous Coronary Interventional technology, perhaps aided by news that private investment in healthcare was soaring throughout the country. Spring opened with 'Health Pods' introduced in an attempt to identify underlying health issues at an earlier stage, whilst female health took centre-stage at the World Congress on Gynaecology and Obstetrics - with the five biggest health problems facing females in the UAE examined. April was a hectic month, and the news continued with the introduction of AI technology that could help children with Autism. It was then revealed that millionaires in the Emirates believed that their health was more important than wealth, before three obesity related stories concluded the month. The first saw attempts to reduce rates in the country recognised at a conference studying the scale of the issue regionwide, before a new study revealed that children's awareness of what constitutes a healthy lifestyle hit an all time high. Just how big an issue childhood obesity is however was illustrated when it was revealed that Sheikh Khalifa Medical City would offer Gastric Balloon surgery to patients as young as 11, albeit only in extreme cases. May opened with a new partnership giving free healthcare to thousands of expats in the country, whilst the demand for healthcare was also hitting record highs. Later in the month we took a special look at new Visa laws in the country, which were great for expats seeking a long-term move to the Emirates. In June a new report illustrated just how impressive the UAE's development in recent years has been - with life expetancy rising by six years nationwide. Perhaps this figure will rise further in the future, thanks to the introduction of new telemedical technology that makes it possible to visit a GP on your phone. Elsewhere it was revealed that secondary infertility rates had risen notably - potentially leading to a decline in population numbers in the future. Technology was back in the news in July, with Virtual Reality advancements helping stroke patients in the UAE to recover. Plans were also revealed for a star-rating system to be introduced for hospitals in Dubai. August was an equally as busy month, with a report praising the Emirates' healthcare system as the best in the Middle East. It was therefore little of a surprise that the UAE (and Saudi Arabia) came ahead of a host of countries (including the United Kingdom) in a report into the wellbeing of the nation. It was also revealed that fewer people than ever were leaving the UAE for medical treatment overseas. The month ended with rare surgery being carried out in Ras-Al-Khamaih to restore the sight of a patient suffering from optic neuritis. As summer became early Autumn, King's College opened a new facilitity based beside Dubai's stunning marina, shortly after a Tuberculosis awareness campaign was launched nationwide - with the aim of totally erradicting the condition. In October another campaign was launched, this time aimed at increasing awareness around the causes of hypertension - and issues relating to it, whilst a month later Breast Cancer was placed in the spotlight. The year concluded with great psychiatric care being offered under the basic healthcare package, with the UAE following global trends in noticing a sharp rise in the number of patients seeking mental health support. Who would be suited to a move? The UAE really is ideal for anyone, but ideally we'd reccomend it to someone with a reasonable degree of experience. Working in the UAE can be quite an independent experience where you will rely on strong problem solving skills, and so it is ideal for someone with more than five years post-training experience. With plenty to do, and the safety and security of compound living, the country is ideal for people with young families. What does the future hold? For now things look fairly secure, with healthcare being seen as the key to driving the economy away from a reliance on oil. This might not be the case longer term however - so if you're looking to spend the rest of your life overseas, the UAE is probably not the ideal location.

W1siziisijiwmtgvmtivmtivmtmvmzkvndmvodu4lze5qxvzdhjhbglhtmv3cy5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

OECD: Australians in Good Health

A new report has shown that Australians are in relatively good health, despite higher than average rates of Cancer and alcohol consumption. Thanks to a recently released online tool compiled by the Australian Institute of Health and Wellbeing (AIHW) it’s now easier than ever to compare Australia’s figures with other OECD nations, and the global average. The figures show that the perceived health status of the nation was the fourth best globally, whilst the country ranked second only to Belgium in the number of long-term care recipients in institutions other than hospitals. It wasn’t all positive however, with Australia well above the OECD average of overweight and obese adults - with rates now at 63.4% compared to 58.1% globally, whilst world leading Japan has obesity rates of just over 25%. Alcohol consumption rates were also higher than average - with Aussies now consuming 9.7 litres per person. Australia also had the world’s second highest Cancer prevalence rate, with 323 out of every 100,000 people facing the condition - a figure well above the global average of 269.3 per 100,000. Thanks to its universal healthcare system Australia was joined by a host of other countries (including New Zealand, the UK and Finland) in having 100% healthcare coverage, whilst the country also had a higher than average uptake for private health cover. Speaking about the survey, and especially the higher than average Cancer rates, Claire Sparke, AIHW spokesperson, said: “We may have higher incidence but we also have higher rates of survival. “The chances of cancer by the time you’re 75 are one in three. If you make it to 85 it’s one in two.” Is a move to Australia something that would interest you? We have a few opportunities available our website - meaning that a dream move could be closer than you might imagine.

W1siziisijiwmtgvmtivmtivmtmvmzavmdcvodkvmtlpzhlzc2v5rxhjbhvzaxzlrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Make the Move 2019 - Australia & New Zealand

It’s at this time of year that many people start considering (or in many cases start re-considering) the idea of a move abroad. A new year brings with it new hopes, a fresh start and the opportunity to do something you’ve been hoping to do for a while. So why not make 2019 the year you finally go for that new life overseas? Over the final five weeks of 2018 we’ve looked at a select group of the countries we work with, and examined why you should make the move in 2019. During this we’ve recapped some of the major news stories from 2018, what sort of person would be suited to a move, and what the future could have in store. In the third installment in the series we’re going to taking a look Australia and New Zealand, two countries that can offer a great standard of living, work/life balance and world leading medical facilities. What made the news in 2018? It was a seriously busy year of news in both Australia and New Zealand, with mental illness especially of concern. This was the case from early January, when the Australian Royal Flying Doctors Service highlighted the major issue of mental health in hard to access rural locations. The same month a report illustrated another serious problem, that Australian men were consuming twice the amount of salt considered safe on a daily basis by the World Health Organisation. Processed food was given much of the blame, with many people unaware of just how unhealthy these can be. After a quiet few months lifestyle related health was in the news again in April, with calls made for cigarette style warnings to be placed on alcohol packaging. In the same month a new survey revealed that a third of office workers in Australia were battling mental health concerns. Spring proved a busy time, with New Zealand marking World Asthma Day by providing those working in education with a 'Teachers' Toolkit' to help deal with any asthma emergencies. Mental illness was back in the news come May, with a survey revealing that there was a 46% increase in young people visiting Emergency departments in Victoria between 2008 and 2015. A week later Melanoma was named as Australia's 'National Cancer' - with 17% of people in the country considered to be at a very high risk. As we moved into summer, shocking new statistics suggested that a third of Australians were unware of some of the rarer health conditions caused by smoking, such as female infertility, Kidney Cancer and Diabetes. Later that month, and in an attempt to fightback against concerning rates of mental illness, New Zealand announced a $10m pilot scheme, which would provide young people in the country with free mental health councilling. The country also went on to announce plans to base psychologists in GP clinics. In August the news agenda changed, with a switch to dentistry - particularly New Zealand's school dental system, after statistics showed that Kiwi schoolchildren were having on average 100 having teeth removed every day. The focus switched back to mental health at the end of Summer, with new statistics showing almost 70% of women in Australia feel anxious or nervous every month. Shortly after, calls were made for a reform of mental health services in New Zealand, with suicide rates in the country increasing by 10% over the course of a year. A busy period of mental health news ended with Australian GPs revealing that it was the most common issue they dealt with only a daily basis. As we reached Autumn it was revealed that Australia is unlikely to hit a WHO target for the reduction of chronic disease, leading to further calls for a 'Sugar Tax'. Mental health returned to the agenda in October, and this time it was New Zealand's rural crisis that was holding the headlines. Research then published in Australia illustrated a direct link between mental health and wealth - with income having no major impact on physical health, but a notable one on psychological issues. The year ended with a focus on maternal health, as it was revealed that more women than ever are now opting for Caesarean Sections in Australia. Who would be suited to a move? Both Australia and New Zealand can be well suited to a wide range of people, from young medics looking for great roles at the start of their careers - to experienced professionals keen to take their skills elsewhere. Out of every group though, we think both countries are perfect for younger medics with experience looking for a long-term move. What does the future hold? Both countries offer stable political climates, whilst funding for healthcare is sustainable and well thought out. As a result, more of the same carefully planned growth in healthcare looks set to be the case for quite a few years to come.

W1siziisijiwmtgvmtivmtivmtmvmzuvmzgvmja3lze5vmlldg5hbu5ld3muanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Liver Cancer Rates Soar in Vietnam

Liver Cancer has overtaken Lung Cancer to become the most prominent type of the condition in Vietnam. It marks the first time in history that rates of the issue have topped national trends in the country, with new figures from ‘Globocan’ showing that 25,334 people contracted Liver Cancer this year, compared to 23,667 who were diagnosed with Lung Cancer. Both rates are extremely high globally, with only Mongolia and Egypt having higher Liver Cancer rates. Inequalities were also clear between men and women - with males three times more likely than females to succumb to the condition. A range of reasons have been given for these extremely concerning figures - but seriously high rates of alcohol and tobacco use look like being the biggest issues. Vietnam has one of the world’s highest smoking rates, with over 16% of the country’s total population smoking on a regular basis. Further to this is the country’s growing alcohol consumption rates - which are some of the highest in Asia. Annually the average Vietnamese adult now consumes 8.3 litres of alcohol a year - considerably more than the likes of China (7.2l), the Philippines (6.6l) and Singapore (2l). Greater education around the risks of excessive tobacco and alcohol use now looks as if it could be the key to reducing both figures, however with rates rising sharply acting quickly could be the key. We occasionally have roles on offer in Vietnam, and with the country’s healthcare market growing quickly we’re expecting it to become increasingly popular in 2019. To get ahead of the rest, register on our website today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtivmduvmtqvmdqvmdqvnzcwlze5r3vszkzlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

FAO: Locums in Saudi Arabia

Have you recently taken up a short-term locum in Saudi Arabia, or is it something that you’re considering? If so then we have some important information to avoid finding yourself in a tricky situation. Unlike most other locations, Saudi Arabia’s Ministry of Health only starts the process of registering you once you’ve arrived in the Kingdom. Once granted, the issue date is backdated to when you first arrived and everything continues as normal. This approach can cause issues for medics taking up short-term (under three month) locums however. Things move slowly in the Desert Kingdom, especially administrative tasks, and so it isn’t uncommon for the registration procedure to take more than three months during busy times or holiday periods. Medics can therefore leave the country before the formalities are complete, putting them in a difficult situation if they return to the United Kingdom and attempt re-register with the GMC. Without a record of registration with the Saudi authorities they have to declare that any work has been carried out illegally - despite this simply being a quirk of the system. Not only will you be unable to apply for accreditation until the paperwork is sorted, it can also damage your reputation. So what can be done? The easiest way to get round this is by ensuring that you don’t leave the country without the backdated registration complete. This will make sure that you avoid any difficulties or unnecessary stresses when re-applying to the GMC. Alternatively - and only in extreme cases where you’ve had to leave without being able to check that the paperwork is complete - you can remove it from your CV, and say that you had taken a career break or holiday. Again this gets round the issue, but we would always recommend doing things by the book. If you haven’t done either, then it becomes a waiting game. You’ll need to stay in regular contact with the Saudi MoH and ensure that they sort everything at their end. This can be a frustrating process however, especially if you’ve got another move lined up, so it’s easier to make sure that everything is tied up prior to your return.

W1siziisijiwmtgvmtivmduvmtmvmjavmjgvodyxlze5s1nbrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Make the Move 2019 - Saudi Arabia

It’s at this time of year that many people start considering (or in many cases start re-considering) the idea of a move abroad. A new year brings with it new hopes, a fresh start and the opportunity to do something you’ve been hoping to do for a while. So why not make 2019 the year you finally go for that new life overseas? Over the final five weeks of 2018 we’ve looked at a select group of the countries we work with, and examined why you should make the move in 2019. During this we’ve recapped some of the major news stories from 2018, what sort of person would be suited to a move, and what the future could have in store. In the second installment in the series we’re going to taking a look at Saudi Arabia, a country that can offer world leading salaries and a unique cultural experience. What made the news in 2018? It was another busy year of healthcare news in the normally secretive 'Desert Kingdom' - although it took until May for the major stories to start flowing, As Spring started to become Summer, research showed a sharp rise in the number of people excercising at least once a week - which had grown from 13% in 2015 to just under 25% by the end of 2017. A large chunk of this success was put down to the Saudi General Sport Authority (GSA) who introduced neighbourhood football leagues, community sports groups and organised the Riyadh Marathon. May and June is always a fascinating time in the Gulf, as the region effectively shuts down to observe Ramadan. This can have a huge impact on everyday life, so we compiled a quick guide looking at what to expect if you're living there. The month concluded with two stories in consecutive days. First a report said that Saudi will require an additional 20,000 hospital beds by 2035, before we took a look at five culture shocks you should prepare for if you choose to move to the Kingdom. A fortnight later Dubai based healthcare giants NMC sealed a deal that made them the second largest healthcare providers in Saudi Arabia. The value of the nation's healthcare market was also estimated to hit $30bn by 2022. Further good news came in a report published at the end of July, which stated that 95% of the Saudi population are generally in good health, whilst a quarter of the adult population went for regular check-ups. It wasn't all positive though, with rates of chronic conditions (especially amongst women) remaining high. Whilst Saudi Arabia isn't for everyone, it certainly has plenty to offer - and so in August we took a look at five of the biggest attractions to the Kingdom. Unlike in other guides however we've totally ignored the financial benefits of a move. August was a busy month in the country, with a global report naming the Saudi Healthcare system as one of the most efficient globally - coming in just six points behind Singapore. As Summer became Autumn the efficient healthcare sector was also named as the largest in the Middle East - boasting world class facilities and talent. Saudi Arabia would also top another report - but this one was less positive - as it was named as the country with the world's largest market for Diabetes, with a quarter of the population now believed to be battling the condition. Shockingly 13% of diabetics in the region are also believed to be undiagnosed. News of the markets growth continued to spread as the year came to a close. 178,000 more beds will be required by 2050, with the country's population set to grow and age significantly over the next 30 years. That strain might be eased by a huge deal however, with Hassana and NMC Health concluding a £1.2bn agreement to develop a new network of facilities nationwide. Who would be suited to a move? Saudi Arabia certainly isn't for everyone, but it can suit most people - if not for a long-term permanent relocation. Most people moving to Saudi Arabia can be split into one of two groups. Either they are going for a fixed-term for financial gains, or they are looking to be in a more familiar environment that is close to their home nation - but financially rewarding. As such we think the country is ideal for Muslims with a background in the Middle East. This will lead to little culture shock, and these people will be comfortable with how ingrained Islam is in everyday life. It can also provide a fascinating cultural experience for expats who have worked globally before however, especially those with a solid background in medicine and a desire to experience something different. With the high cost of education and restrictive lifestyle, we wouldn't recommend it for families with teenage children. The safe, friendly compounds can be great for younger children however - especially if a move is only for a short period of time. What does the future have in store? Saudi Arabia has been built on an oil-driven economy, however as the world begins to move on so too has the Kingdom. Building one of the Gulf's best healthcare sectors is a key aim, and with generous funding and a passion for the highest possible quality, a move should be relatively futureproof.

W1siziisijiwmtgvmtivmduvmtmvndivmjmvmty5l1vbru5ld3mucg5nil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

Flu Rates Soar in UAE

The UAE has reported a far higher than average demand for the flu vaccine, after an unexpected increase in the number of cases already this winter. This has lead to a shortage of the vaccine in the Northern Emirates of Sharjah, Dubai, Ajman and Ras, with waiting times for appointments in some clinics now stretching for a couple of weeks. Abu Dhabi appears to have bucked the trend, with vaccines available at plenty of facilities - and rates remaining more settled than elsewhere. Speaking to the Khaleej Times about the flu season, internal medicine consultant at Burjeel Day Hospital, Dr Fadi Baladi, said: “People start thinking about flu between the end of September and early November, and at that time we are vaccinating tens of patients each day. “Recently though more patients have been coming in for the flu vaccine as a result of more news about people becoming unwell.” This year flu has already lead to two deaths; one involving a 17 year old student, and another in the case of a nine year old schoolgirl. Currently the UAE’s Ministry of Health recommends the flu jab to everyone over the age of six months, without allergies to any of the vaccines components. Special priority is given to those with underlying health conditions (such as heart disease, asthma and diabetes), as well as the elderly and pregnant women. It costs around Dh60 (£12), but with demand high anyone in a risk group who hasn’t yet been vaccinated is urged to book an appointment as soon as possible. Would working in the UAE interest you? We’ve got a range of roles on offer on our website, so register with us today. A dream move could be closer than you might imagine.

W1siziisijiwmtgvmtevmjgvmtivmjqvmzevndk5lze5q2fuywrhrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

test video

test video text

W1siziisijiwmtgvmtevmjgvmtivndavmdevndy0lze5qxvzdhjhbglhrmvhdhvyzs5qcgcixsxbinailcj0ahvtyiisijmwmhgzmdbcdtawm2uixv0

Mental Health Young Australians' Biggest Issue

Mental health is the biggest issue facing young Australians in 2018 according to a newly released report. Data published in Mission Australia’s annual youth survey has shown that 43% of people between the ages of 15 and 19 believe that mental health is the biggest issue in the country. Remarkably this figure has more than doubled over the past three years - with concerns now 14% higher than those around drug and alcohol abuse. Mental health was also highlighted in the personal concerns section of the report, with stress (43%) and mental illness (31%) identified as the first and third biggest individual worries respectively. As a result of their findings, Mission Australia - one of the largest charitable providers of community services in the country - have recommended the introduction of universal evidence based mental health programs, along with greater access to support networks for young people. The organisation’s state director for New South Wales, Victoria, and Capital Territory, Nada Nassan, stressed how important it was to respond to the findings. She said: “As a priority we must ensure that this increased awareness goes hand-in-hand with adequate access to the right help when needed. Access to appropriate and timely support can make a real difference in a young person’s life. “We must see more investment in evidence based programs that promote mental health and wellbeing in schools, as well as holistic support for young people that meets a range of needs during adolescence; such as assistance with school or study problems and coping with stress.” Could you help Australia in the country’s battle with mental illness? If a move would interest you then register on our website today - a dream role could be closer than you might imagine.

W1siziisijiwmtgvmtevmtkvmtmvntavmzivntaxlze5r3vszkzlyxr1cmuuanbnil0swyjwiiwidgh1bwiilcizmdb4mzawxhuwmdnlil1d

HSBC Expat Explorer 2018 - Part 2 - The Gulf

HSBC has published the results of its annual ‘Expat Explorer’ survey, with Singapore once again leading the way as the most popular location for expats globally. In the second of a two part special we’ve examined the results from the Gulf region - the most popular with medics seeking a more rewarding career overseas. Part One is Available Here Bahrain - 5th (+4) Surprised? You shouldn’t be. Bahrain is one of the Gulf’s hidden gems - bringing together a relaxed island mentality with traditional Arab culture. Expats Loved Bahrain was considered the best location globally for wage growth The country scored highly across all financial indicators The high quality of childcare and educational facilities An open and tolerant society The outstanding work/life balance How safe the country was for families Expats’ Downsides The cost of childcare was high Compound living made integration difficult Traditional food and a lack of fitness facilities saw a move have a detrimental impact on expats’ health The heavily westernised culture United Arab Emirates - 10th (-3) The UAE remains a firm favourite with expats, even if it has slipped three positions over the past 12 months. Expats Loved A move had a hugely positive financial impact The country’s stable government and increasingly liberal laws earned praise The UAE was rated as one of the world’s safest locations The Emirates are great for entrepreneurs The quality of childcare and education is extremely high Expats’ Downsides There are few remnants of traditional culture - especially in the expat hubs It was expensive to raise children Expats found it very difficult to integrate into society Saudi Arabia - 26th (+3) Saudi Arabia rises, but remains in the lower half of the table. Expats Loved 2nd best location in the world for enhancing savings 4th best for wage growth Job security was high, with many people working within vital industries The country’s impressive healthcare system scored well The value for money and standard of accommodation on offer Expats’ Downsides Expats found adapting to the country’s culture difficult A move wasn’t great for career progression With little entertainment on offer expats said that their social lives suffered Interested in relocating to any of the locations mentioned in this article? Register on our website for job alerts today. A life changing move could be closer than you might imagine.

W1siziisijiwmtgvmtevmtkvmtmvntgvmtuvmzy0l09tyw5ozxdzlnbuzyjdlfsiccisinrodw1iiiwimzawedmwmfx1mdazzsjdxq

Oman News Roundup

Fertility Rates Continue to Drop Oman’s fertility rate is continuing to drop, with a new United Nations report showing that it currently sits at 2.7 births per woman. Whilst this is still considerably higher than in the West, where rates in Germany and the United Kingdom range from 1.5 to 1.8, it represents a staggering drop since 1980, when the average Omani woman gave birth more than eight times. The report shows that women in Oman now have greater freedom - with the Sultanate’s Government pleased about the impact a lower number of children will have on educational facilities. Speaking on behalf of the United Nations Population Fund, Asr Ahmad Toussoun, explained the positive impact a lower birth rate can have. He said: “Birth spacing and the empowerment of women drive the pace of economic and social progress in the world.” Boost for Thalassemia Patients A joint partnership between the Omani Ministry of Health and Novartis is set to bring the latest iron-overload treatments to the Sultanate. Government data suggests that as many as 75% of patients visiting clinics have an inherited blood disorder - with sickle cell disease, thalassemia and glucose-6-phosphate dehydrogenase the most common. Now the MOH and Novartis, who launched their first iron-overload medication back in 1968, have made new film-coated tablets available - making treatment quick and convenient. The new partnership is just one of many ways that the Omani health ministry is attempting to deal with Thalassemia - with premarital screening already widespread, and work to reduce the traditional attitudes towards the issue also underway. Mandatory Health Insurance to be Introduced Oman is set to follow regional trends by introducing mandatory health insurance for workers in the country. According to a recent article in ‘Muscat Daily’ preparations are already underway for the introduction, which would see the country follow the likes of the United Arab Emirates by making insurance mandatory. Oman’s approach has been typically meticulous, with the Ministry of Health creating a team of experts to create regulations that a perfectly suited to the market conditions. Rumours suggest that insurance could be mandatory as early as next year. Interested in a move to Oman? We currently have a couple of openings on our website - register today and start your Odyssey.

CV Tailoring

Knowledge Base

Interview Training

Global Mobility

VISAs and Passports

Emergency Medicine Physician - Paediatric Emergency Medicine - Consultant - Saudi Arabia

Emergency Medicine Physician - Consultant - Saudi Arabia

Radiologist Consultant - New Zealand

Pulmonologist Consultant - Saudi Arabia

Ophthalmologist Consultant - Saudi Arabia

Urologist Consultant - Saudi Arabia

Endocrinologist Consultant - Saudi Arabia

Consultant Psychiatrist Locum - Child and Adolescent - New Zealand

Psychiatrist Consultant - Child and Adolescent - New Zealand

Intensivist Consultant - Mecca - Saudi Arabia

Emergency Medicine Physician

Emergency Medicine Specialist - Saudi Arabia

Emergency Medicine Specialist - Saudi Arabia

Paediatric Emergency Medicine Specialist - Saudi Arabia

Internist - Canada

Emergency Medicine Physician - Beijing - China

Emergency Medicine Physician - Shanghai - China

Emergency Medicine Physician - Guangzhou - China

Radiographer - PET / CT - Cork - Ireland

Radiographer - MRI - Dublin

Radiographer - MRI - Limerick - Ireland

Radiographer - MRI - Dublin Ireland

Family Physician Consultant -Jeddah - Saudi Arabia

Senior Radiographer - Mammography

Plastic Surgeon Consultant - Saudi Arabia

Cardiologist (Non Interventional) - Saudi Arabia

Dermatologist Specialist - Saudi Arabia

Dermatologist Consultant - Saudi Arabia

Dermatologist Consultant - Saudi Arabia

ANAESTHETIST - CANADA - SALARIED OR FEE FOR SERVICE

Orthopaedic Surgeon - New Zealand

Psychiatrist Consultant - Child & Adolescent Psychiatry - New Zealand

Radiologist Consultant - Diagnostic and Interventional Radiologist - New Zealand

Endocrinologist

GENERAL PRACTITIONER - FAMILY PHYSICIAN - AUSTRALIA

IVF Consultant - Oman

Obstetrician and Gynaecologist Consultant - Oman

Plastic Surgeon Consultant - Dubai - UAE

Director of In Vitro Fertilisation (IVF) Department - Al Khobar - Saudi Arabia

Obstetrician and Gynaecologist Consultant in In Vitro Fertilisation (IVF)

DISTRICT MEDICAL OFFICER LOCUM - AUSTRALIA

DISTRICT MEDICAL OFFICER - AUSTRALIA

Chief of Dentistry - Beijing China

Paediatrician Consultant - Shanghai China

Paediatrician Consultant - Beijing China

Orthopaedic Surgeon - Paediatric Orthopaedics - Beijing China

Plastic Surgeon - Salaried or FFS

Neurologist

Urologist

Orthopaedic Surgeon